DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab6 and rab36

DIOPT Version :9

Sequence 1:NP_001285869.1 Gene:Rab6 / 34636 FlyBaseID:FBgn0015797 Length:208 Species:Drosophila melanogaster
Sequence 2:XP_004910645.2 Gene:rab36 / 733793 XenbaseID:XB-GENE-490801 Length:264 Species:Xenopus tropicalis


Alignment Length:173 Identity:66/173 - (38%)
Similarity:96/173 - (55%) Gaps:5/173 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLW 66
            ::|..|  |:..|.|.:|:..|||||||.||..:.||..|:||||:||..:...:.......|:|
 Frog    46 NAGAIG--LKMSKAVMVGDLYVGKTSLINRFCKNVFDRDYKATIGVDFEIERFEILGIPFNFQIW 108

  Fly    67 DTAGQERFRSLIPSYIRDSTVAVVVYDITNTNSFHQTSKWIDDVRTERGSDVI-IMLVGNKTD-L 129
            ||||||:|:.:..:|.|.:.|.:..:|:.:.::...|.:|:.|...|...|.. |.|||.|.| |
 Frog   109 DTAGQEKFKCIASAYYRGAQVIITAFDLGDISTLENTRRWVQDALKENEPDTCSIFLVGTKKDTL 173

  Fly   130 SDKRQVSTE-EGERKAKELNVMFIETSAKAGYNVKQLFRRVAA 171
            |:.....|| :..|.|.:|...:...|||.|.|||:.|.|||:
 Frog   174 SEAELERTEQDAVRLAIDLQAEYWSVSAKTGENVKEFFFRVAS 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab6NP_001285869.1 Rab6 13..173 CDD:206654 63/162 (39%)
rab36XP_004910645.2 P-loop_NTPase 55..220 CDD:422963 63/162 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.