DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab6 and Rab36

DIOPT Version :9

Sequence 1:NP_001285869.1 Gene:Rab6 / 34636 FlyBaseID:FBgn0015797 Length:208 Species:Drosophila melanogaster
Sequence 2:XP_006256404.1 Gene:Rab36 / 690407 RGDID:1596098 Length:331 Species:Rattus norvegicus


Alignment Length:220 Identity:78/220 - (35%)
Similarity:109/220 - (49%) Gaps:17/220 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLW 66
            ::|..|  ||..|:|.:|:..|||||||.|...:.||..|:||||:||..:...:......||:|
  Rat   113 NTGTAG--LRLSKVVVVGDLYVGKTSLIHRLCKNVFDRDYKATIGVDFEIERFEIAGIPYSLQIW 175

  Fly    67 DTAGQERFRSLIPSYIRDSTVAVVVYDITNTNSFHQTSKWIDDV-RTERGSDVIIMLVGNKTDLS 130
            ||||||:|:.:..:|.|.:.|.:..:|:|:..:...|.:|:.|| |........|.|||.|.||.
  Rat   176 DTAGQEKFKCIASAYYRGAQVIITAFDLTDVQTLEHTKQWLQDVLRENEAGSCFIFLVGTKKDLL 240

  Fly   131 DKRQVSTEEGE--RKAKELNVMFIETSAKAGYNVKQLFRRVAAAL---PGMDSTENKPSEDMQ-- 188
            ........|.|  ..|.|:...:...|||.|.|||..|.||||..   ..:...|.:||...|  
  Rat   241 SGAACEQAEAEAVHLANEMQAEYWSVSAKTGENVKAFFSRVAALAFEQSVLQDLEKRPSTQSQVG 305

  Fly   189 ----EVVLKDSP--NETKDPEG-GC 206
                :::..:.|  .|.|.|.| ||
  Rat   306 DGDGDLIRIEVPKTQENKRPPGLGC 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab6NP_001285869.1 Rab6 13..173 CDD:206654 63/162 (39%)
Rab36XP_006256404.1 P-loop_NTPase 122..287 CDD:304359 63/164 (38%)
Ras 123..279 CDD:278499 58/155 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0094
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.