DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab6 and rab6ba

DIOPT Version :9

Sequence 1:NP_001285869.1 Gene:Rab6 / 34636 FlyBaseID:FBgn0015797 Length:208 Species:Drosophila melanogaster
Sequence 2:XP_005165989.1 Gene:rab6ba / 558900 ZFINID:ZDB-GENE-050809-136 Length:258 Species:Danio rerio


Alignment Length:209 Identity:177/209 - (84%)
Similarity:188/209 - (89%) Gaps:2/209 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSG-DFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQ 64
            ||.| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Zfish    51 MSVGNDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQ 115

  Fly    65 LWDTAGQERFRSLIPSYIRDSTVAVVVYDITNTNSFHQTSKWIDDVRTERGSDVIIMLVGNKTDL 129
            ||||||||||||||||||||||||||||||||.|||.||||||||||||||||||||||||||||
Zfish   116 LWDTAGQERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTSKWIDDVRTERGSDVIIMLVGNKTDL 180

  Fly   130 SDKRQVSTEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMDSTENKPSEDMQEVVLKD 194
            :||||::.||||::||||:|||||||||.||||||||||||||||||:|.:....|.|.::.| |
Zfish   181 ADKRQITIEEGEQRAKELSVMFIETSAKTGYNVKQLFRRVAAALPGMESMQETSKEGMIDIKL-D 244

  Fly   195 SPNETKDPEGGCAC 208
            .|.|....||||:|
Zfish   245 KPQEPPTTEGGCSC 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab6NP_001285869.1 Rab6 13..173 CDD:206654 149/159 (94%)
rab6baXP_005165989.1 Rab6 64..224 CDD:206654 149/159 (94%)
RAB 64..221 CDD:197555 146/156 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0094
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 356 1.000 Inparanoid score I2202
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1277051at2759
OrthoFinder 1 1.000 - - FOG0000767
OrthoInspector 1 1.000 - - otm24328
orthoMCL 1 0.900 - - OOG6_100976
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X452
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.