DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab6 and rab6bb

DIOPT Version :9

Sequence 1:NP_001285869.1 Gene:Rab6 / 34636 FlyBaseID:FBgn0015797 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001013485.1 Gene:rab6bb / 541339 ZFINID:ZDB-GENE-050320-28 Length:208 Species:Danio rerio


Alignment Length:212 Identity:174/212 - (82%)
Similarity:185/212 - (87%) Gaps:8/212 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSG-DFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQ 64
            ||.| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Zfish     1 MSMGSDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQ 65

  Fly    65 LWDTAGQERFRSLIPSYIRDSTVAVVVYDITNTNSFHQTSKWIDDVRTERGSDVIIMLVGNKTDL 129
            ||||||||||||||||||||||||||||||||.|||..|||||||||||||||||||||||||||
Zfish    66 LWDTAGQERFRSLIPSYIRDSTVAVVVYDITNINSFQLTSKWIDDVRTERGSDVIIMLVGNKTDL 130

  Fly   130 SDKRQVSTEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMDSTENKPSEDMQEVVLKD 194
            .:|||::.||||::||||||||||||||.|.||||||||||||||||:|.::...|.|.::.|..
Zfish   131 EEKRQITIEEGEQRAKELNVMFIETSAKTGSNVKQLFRRVAAALPGMESLDDNNKEGMIDIKLDK 195

  Fly   195 SPNETKDP---EGGCAC 208
            .|    ||   |.||:|
Zfish   196 QP----DPPATESGCSC 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab6NP_001285869.1 Rab6 13..173 CDD:206654 147/159 (92%)
rab6bbNP_001013485.1 Rab6 14..174 CDD:206654 147/159 (92%)
RAB 14..171 CDD:197555 144/156 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0094
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H134129
Inparanoid 1 1.050 356 1.000 Inparanoid score I2202
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1277051at2759
OrthoFinder 1 1.000 - - FOG0000767
OrthoInspector 1 1.000 - - otm24328
orthoMCL 1 0.900 - - OOG6_100976
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X452
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.730

Return to query results.
Submit another query.