DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab6 and rab34a

DIOPT Version :9

Sequence 1:NP_001285869.1 Gene:Rab6 / 34636 FlyBaseID:FBgn0015797 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001006094.1 Gene:rab34a / 450074 ZFINID:ZDB-GENE-041010-197 Length:260 Species:Danio rerio


Alignment Length:161 Identity:63/161 - (39%)
Similarity:95/161 - (59%) Gaps:3/161 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLI 78
            |::.:|:.:||||.||.||..|.||..|:||||:||..:...:......||||||||||||:.:.
Zfish    55 KVIVVGDLAVGKTCLINRFCKDVFDKNYKATIGVDFEMERFEVLGVPFSLQLWDTAGQERFKCIA 119

  Fly    79 PSYIRDSTVAVVVYDITNTNSFHQTSKWIDDVRTERG-SDVIIMLVGNKTDLSDKRQVSTEEGE- 141
            .:|.|.:...::|:|:|:..|...|.:|::|...|.. :.|::.|||.|.|||...|.|..|.: 
Zfish   120 STYYRGAQAVIIVFDLTDVASLEHTRQWLEDAMKENDPTSVLLFLVGTKKDLSSPAQYSLIEQDA 184

  Fly   142 -RKAKELNVMFIETSAKAGYNVKQLFRRVAA 171
             :.|.::...:...||.:|.||:..|.|||:
Zfish   185 IKIADQMKAEYWALSALSGENVRDFFFRVAS 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab6NP_001285869.1 Rab6 13..173 CDD:206654 63/161 (39%)
rab34aNP_001006094.1 Rab36_Rab34 54..221 CDD:206693 63/161 (39%)
RAB 55..214 CDD:197555 61/158 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0094
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.