DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab6 and rab41

DIOPT Version :9

Sequence 1:NP_001285869.1 Gene:Rab6 / 34636 FlyBaseID:FBgn0015797 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_998530.1 Gene:rab41 / 406674 ZFINID:ZDB-GENE-040426-2686 Length:211 Species:Danio rerio


Alignment Length:205 Identity:173/205 - (84%)
Similarity:183/205 - (89%) Gaps:1/205 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDT 68
            |:||:||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Zfish     8 GEFGDPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDT 72

  Fly    69 AGQERFRSLIPSYIRDSTVAVVVYDITNTNSFHQTSKWIDDVRTERGSDVIIMLVGNKTDLSDKR 133
            ||||||||||||||||||:|||||||||.|||.||||||||||||||||||||||||||||.|||
Zfish    73 AGQERFRSLIPSYIRDSTIAVVVYDITNLNSFQQTSKWIDDVRTERGSDVIIMLVGNKTDLGDKR 137

  Fly   134 QVSTEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMDSTENKPSEDMQEVVLKDSPNE 198
            |||.|..|:||:||.||:||||||||||||||||||||||||||||..|..|||.::.| :.|.|
Zfish   138 QVSVEAAEKKARELGVMYIETSAKAGYNVKQLFRRVAAALPGMDSTPEKSKEDMIDIKL-EKPPE 201

  Fly   199 TKDPEGGCAC 208
            ....|..|:|
Zfish   202 LPVTESSCSC 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab6NP_001285869.1 Rab6 13..173 CDD:206654 148/159 (93%)
rab41NP_998530.1 Rab6 17..177 CDD:206654 148/159 (93%)
RAB 17..174 CDD:197555 145/156 (93%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595983
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0094
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 356 1.000 Inparanoid score I2202
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1277051at2759
OrthoFinder 1 1.000 - - FOG0000767
OrthoInspector 1 1.000 - - otm24328
orthoMCL 1 0.900 - - OOG6_100976
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X452
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.660

Return to query results.
Submit another query.