DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab6 and Rab26

DIOPT Version :9

Sequence 1:NP_001285869.1 Gene:Rab6 / 34636 FlyBaseID:FBgn0015797 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001097658.1 Gene:Rab26 / 40359 FlyBaseID:FBgn0086913 Length:410 Species:Drosophila melanogaster


Alignment Length:162 Identity:73/162 - (45%)
Similarity:107/162 - (66%) Gaps:2/162 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KLVFLGEQSVGKTSLITRFMYDSFDNTY-QATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSL 77
            |::.||:..||||||:.||....:..:| .:|:||||.:|.:.::...|:||:|||||||||||:
  Fly   214 KVIMLGDSGVGKTSLLIRFRDGRYVPSYFLSTVGIDFRNKVVVVDGTRVKLQIWDTAGQERFRSV 278

  Fly    78 IPSYIRDSTVAVVVYDITNTNSFHQTSKWIDDVRTERGSDVIIMLVGNKTDLS-DKRQVSTEEGE 141
            ..:|.||:...:::||:||..::.....|:.::|.....||:|:|:|||.|.| .:|||..|:||
  Fly   279 THAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIREYAQEDVVIVLIGNKADCSGSERQVKREDGE 343

  Fly   142 RKAKELNVMFIETSAKAGYNVKQLFRRVAAAL 173
            |..:|.||.|:|||||.|.||:..|..||..|
  Fly   344 RLGREHNVPFMETSAKTGLNVELSFTAVARQL 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab6NP_001285869.1 Rab6 13..173 CDD:206654 72/160 (45%)
Rab26NP_001097658.1 Rab26 214..407 CDD:206695 73/162 (45%)
RAB 214..378 CDD:197555 73/162 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454178
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.