DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab6 and rab6a

DIOPT Version :9

Sequence 1:NP_001285869.1 Gene:Rab6 / 34636 FlyBaseID:FBgn0015797 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_989315.1 Gene:rab6a / 394940 XenbaseID:XB-GENE-494903 Length:208 Species:Xenopus tropicalis


Alignment Length:207 Identity:180/207 - (86%)
Similarity:192/207 - (92%) Gaps:1/207 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLW 66
            :.|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
 Frog     3 AGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLW 67

  Fly    67 DTAGQERFRSLIPSYIRDSTVAVVVYDITNTNSFHQTSKWIDDVRTERGSDVIIMLVGNKTDLSD 131
            |||||||||||||||||||||||||:||||.|||.||:|||||||||||||||||||||||||:|
 Frog    68 DTAGQERFRSLIPSYIRDSTVAVVVFDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLAD 132

  Fly   132 KRQVSTEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMDSTENKPSEDMQEVVLKDSP 196
            |||||.|||||||||||||||||||||||||||||||||||||||:|:::|..|||.::.| :.|
 Frog   133 KRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMESSQDKSREDMIDIKL-EKP 196

  Fly   197 NETKDPEGGCAC 208
            .|....||||:|
 Frog   197 PEQPVSEGGCSC 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab6NP_001285869.1 Rab6 13..173 CDD:206654 153/159 (96%)
rab6aNP_989315.1 Rab6 14..174 CDD:206654 153/159 (96%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 302 1.000 Domainoid score I1393
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134129
Inparanoid 1 1.050 357 1.000 Inparanoid score I2176
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1277051at2759
OrthoFinder 1 1.000 - - FOG0000767
OrthoInspector 1 1.000 - - otm49338
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X452
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.