DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab6 and RabX5

DIOPT Version :9

Sequence 1:NP_001285869.1 Gene:Rab6 / 34636 FlyBaseID:FBgn0015797 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_647644.2 Gene:RabX5 / 38209 FlyBaseID:FBgn0035255 Length:277 Species:Drosophila melanogaster


Alignment Length:233 Identity:77/233 - (33%)
Similarity:121/233 - (51%) Gaps:29/233 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DFGNPLR---------KF---KLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLE 57
            |||..:|         ||   |::|:|:.|||||:::.||.||.|.:.|:||||:||..:...:.
  Fly    45 DFGAQVRYYLEAPRKPKFRPCKVIFVGDCSVGKTAIVNRFCYDKFQSNYKATIGVDFELENFSIL 109

  Fly    58 DRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNTNSFHQTSKWIDDVRTERGSD-VIIM 121
            .....|::||||||||||.:..:|.|:::|.||.||::..:|.....||::.......|. .::.
  Fly   110 GHNYSLEMWDTAGQERFRCIAGAYYRNASVIVVTYDMSKKDSLESAKKWLNSALNYNASKRPLVF 174

  Fly   122 LVGNKTDLSDKRQVSTEE--GERKAKELNVMFIETSAKAGYNVKQLFRRVA------AALPGMDS 178
            |||.|.||..|.:....|  ....|.||...:...||::|:.|.:||:|:|      |.:..:.|
  Fly   175 LVGTKADLLSKEEFVRMERLAGLAAAELQAEYWSVSARSGFKVTELFQRIAALAFEEAVMQEIRS 239

  Fly   179 TENKPSEDMQEVVLKDSPNETKD--------PEGGCAC 208
            .:|||.|...:..:|....:.::        .:.||.|
  Fly   240 IKNKPQEQATQASVKSQTFDLRNFFGSRLSQQKSGCTC 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab6NP_001285869.1 Rab6 13..173 CDD:206654 63/171 (37%)
RabX5NP_647644.2 P-loop_NTPase 66..230 CDD:304359 61/163 (37%)
RAB 66..225 CDD:197555 60/158 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454193
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0094
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.