DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab6 and RabX6

DIOPT Version :9

Sequence 1:NP_001285869.1 Gene:Rab6 / 34636 FlyBaseID:FBgn0015797 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster


Alignment Length:211 Identity:60/211 - (28%)
Similarity:111/211 - (52%) Gaps:19/211 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KFKLVFLGEQSVGKTSLITRFMYDSF--DNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERF 74
            |.|::..|:..|||:||..||..::|  |...::|:|:|.:.:...:.::.::||||||.|.||.
  Fly     8 KQKVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGMERV 72

  Fly    75 RSLIPSYIRDSTVAVVVYDITNTNSFHQTSKWIDDVRTERGSDVIIMLVGNKTDLSDKR-QVSTE 138
            .|:..||.:.:..|::|:.:.|..|||..|:.:.|:.| ...:..|.:.|||:||..:. :||.|
  Fly    73 ASVTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVT-YAENAKIFICGNKSDLDGREPEVSDE 136

  Fly   139 EGERKAKELNVMF---IETSAKAGYNVKQLFRRVAAALPGMDSTENKPSEDMQEVVLKDSPNET- 199
            |.|...::.:.:.   .:||.::|..|:::||.::..|    ...|:...::|.:..|....:| 
  Fly   137 EVEAFCEQCHSLISATYKTSCRSGAGVEEMFRDISRQL----VHANRSKMELQALEHKSFQVDTA 197

  Fly   200 -------KDPEGGCAC 208
                   ::....|.|
  Fly   198 SSGAATNEEDASSCGC 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab6NP_001285869.1 Rab6 13..173 CDD:206654 52/165 (32%)
RabX6NP_001261219.1 RAB 10..176 CDD:197555 53/170 (31%)
Rab 10..172 CDD:206640 52/162 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.