DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab6 and Rab6b

DIOPT Version :9

Sequence 1:NP_001285869.1 Gene:Rab6 / 34636 FlyBaseID:FBgn0015797 Length:208 Species:Drosophila melanogaster
Sequence 2:XP_006243731.1 Gene:Rab6b / 363123 RGDID:1309958 Length:208 Species:Rattus norvegicus


Alignment Length:207 Identity:174/207 - (84%)
Similarity:188/207 - (90%) Gaps:1/207 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLW 66
            :.|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat     3 AGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLW 67

  Fly    67 DTAGQERFRSLIPSYIRDSTVAVVVYDITNTNSFHQTSKWIDDVRTERGSDVIIMLVGNKTDLSD 131
            ||||||||||||||||||||||||||||||.|||.||||||||||||||||||||||||||||:|
  Rat    68 DTAGQERFRSLIPSYIRDSTVAVVVYDITNLNSFQQTSKWIDDVRTERGSDVIIMLVGNKTDLAD 132

  Fly   132 KRQVSTEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMDSTENKPSEDMQEVVLKDSP 196
            |||::.||||::||||:|||||||||.||||||||||||:|||||::.:.|..|.|.::.| |.|
  Rat   133 KRQITIEEGEQRAKELSVMFIETSAKTGYNVKQLFRRVASALPGMENVQEKSKEGMIDIKL-DKP 196

  Fly   197 NETKDPEGGCAC 208
            .|....||||:|
  Rat   197 QEPPASEGGCSC 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab6NP_001285869.1 Rab6 13..173 CDD:206654 148/159 (93%)
Rab6bXP_006243731.1 Rab6 14..174 CDD:206654 148/159 (93%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0094
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 359 1.000 Inparanoid score I2143
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1277051at2759
OrthoFinder 1 1.000 - - FOG0000767
OrthoInspector 1 1.000 - - otm46253
orthoMCL 1 0.900 - - OOG6_100976
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X452
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.730

Return to query results.
Submit another query.