DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab6 and Rab9

DIOPT Version :9

Sequence 1:NP_001285869.1 Gene:Rab6 / 34636 FlyBaseID:FBgn0015797 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_609966.1 Gene:Rab9 / 35221 FlyBaseID:FBgn0032782 Length:256 Species:Drosophila melanogaster


Alignment Length:161 Identity:57/161 - (35%)
Similarity:94/161 - (58%) Gaps:11/161 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLI 78
            |:|.||:..|||::|:|||:.:.::.....|||::|::|.:.::.....||:||||||||||:|.
  Fly    14 KVVILGDGGVGKSALLTRFVANRYEENNFHTIGVEFMNKDIVVDGERYTLQIWDTAGQERFRALR 78

  Fly    79 PSYIRDSTVAVVVYDITNTNSFHQTSKWID------DVRTERGSDVIIMLVGNKTDL-SDKRQVS 136
            ..:.|.|.:.::.|.:.:.:|......|.:      ||..::...::   ||||.|: :.|||||
  Fly    79 TPFYRGSDICLLCYALDDRDSLKGLGVWRNEFLNYADVDQDKFPFIV---VGNKNDIPAQKRQVS 140

  Fly   137 TEEGERKAKELNV-MFIETSAKAGYNVKQLF 166
            ::..::...|..| ..||||:||..||...|
  Fly   141 SDAVQQWCAEQKVACHIETSSKAATNVTDAF 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab6NP_001285869.1 Rab6 13..173 CDD:206654 57/161 (35%)
Rab9NP_609966.1 Rab9 8..178 CDD:206697 57/161 (35%)
Ras 14..177 CDD:278499 57/161 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454188
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.