DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab6 and Rab14

DIOPT Version :9

Sequence 1:NP_001285869.1 Gene:Rab6 / 34636 FlyBaseID:FBgn0015797 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster


Alignment Length:211 Identity:71/211 - (33%)
Similarity:113/211 - (53%) Gaps:22/211 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSL 77
            ||.:.:|:..|||:.|:.:|....|......|||::|.::.:.::|:.::||:||||||||||::
  Fly    36 FKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQERFRAV 100

  Fly    78 IPSYIRDSTVAVVVYDITNTNSFHQTSKWIDDVRTERGSDVIIMLVGNKTDLSDKRQVSTEEGER 142
            ..||.|.:..|::|||||..::::..|.|:.|.|.......:|.|:|||:||...|:|:.||.:.
  Fly   101 TRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTREVTYEEAKE 165

  Fly   143 KAKELNVMFIETSAKAGYNVKQLFRRVA---------------AALPGMDSTENKPSEDMQEVVL 192
            .|.|..:||:|.||..|.||::.|...|               |:..|:....::||    ...|
  Fly   166 FADENGLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRLDLNASESGVQHRPSQPS----RTSL 226

  Fly   193 KDSPNETKDPEGGCAC 208
            .......||.   |:|
  Fly   227 SSEATGAKDQ---CSC 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab6NP_001285869.1 Rab6 13..173 CDD:206654 63/174 (36%)
Rab14NP_788056.1 Rab14 34..199 CDD:133322 62/162 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454176
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.