DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab6 and Rab21

DIOPT Version :9

Sequence 1:NP_001285869.1 Gene:Rab6 / 34636 FlyBaseID:FBgn0015797 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001036321.2 Gene:Rab21 / 3355163 FlyBaseID:FBgn0039966 Length:222 Species:Drosophila melanogaster


Alignment Length:228 Identity:85/228 - (37%)
Similarity:128/228 - (56%) Gaps:29/228 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSGDFGN-PLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLED-RTVRL 63
            |||....| |...||.|.|||..||||||:.|:|.|.|:..:.:|:...|:|:.|.||| |..:|
  Fly     1 MSSSRTRNGPTLNFKAVLLGEGCVGKTSLVLRYMEDRFNAQHLSTLQASFVSRKMSLEDGRRAQL 65

  Fly    64 QLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNTNSFHQTSKWIDDVRTERGSDVIIMLVGNKTD 128
            .:|||||||||.:|.|.|.|.|..|::|||||:.:||.:...|:.::|..||:::.:::||||||
  Fly    66 NIWDTAGQERFHALGPIYYRGSDGALLVYDITDRDSFQKVKSWVRELRQMRGTEIALIIVGNKTD 130

  Fly   129 LSDKRQVSTEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAAL------------------PG 175
            |.::|.|:.:|..:.|:.:...::|||||....|.:||..:...:                  |.
  Fly   131 LEEQRAVTHDEALQYARTVGAQYVETSAKENEGVAELFELLTQLMLEQLSQRQPDASPLRLQNPD 195

  Fly   176 MDSTENKPSEDMQEVVLKDSPNETKDPEGGCAC 208
            .|:..|  |:|      .::| :..||.|..:|
  Fly   196 TDNLNN--SDD------SEAP-DPGDPAGQRSC 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab6NP_001285869.1 Rab6 13..173 CDD:206654 70/160 (44%)
Rab21NP_001036321.2 Rab21 14..176 CDD:133323 70/161 (43%)
Ras 15..177 CDD:278499 69/161 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454185
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.