DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab6 and Rab35

DIOPT Version :9

Sequence 1:NP_001285869.1 Gene:Rab6 / 34636 FlyBaseID:FBgn0015797 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001188678.1 Gene:Rab35 / 33014 FlyBaseID:FBgn0031090 Length:201 Species:Drosophila melanogaster


Alignment Length:199 Identity:78/199 - (39%)
Similarity:124/199 - (62%) Gaps:10/199 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSL 77
            |||:.:|:..|||:||:.||..|:|..:|..|||:||..:|:.:|...|:||:||||||||||::
  Fly     9 FKLLIIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTVDIEGMRVKLQIWDTAGQERFRTI 73

  Fly    78 IPSYIRDSTVAVVVYDITNTNSFHQTSKWIDDVRTERGSDVI-IMLVGNKTDLSDKRQVSTEEGE 141
            ..:|.|.:...:||||:||..||....:|::::  :...||: .:|||||.|..|::.|.||:.:
  Fly    74 TSTYYRGTHGVIVVYDVTNGESFANVRRWLEEI--QNNCDVVKKVLVGNKNDDPDRKVVITEDAQ 136

  Fly   142 RKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMD-STENKPSEDMQEVV-LKDSPNETKDPEG 204
            |.||::::...|||||...||:.:|..:...:  :| .....|:|..::.: ||.:|   |..:|
  Fly   137 RFAKQMDIELFETSAKDNINVENMFLSITRQV--LDHKLRTSPNEQQKDTLHLKPNP---KGSKG 196

  Fly   205 GCAC 208
            |..|
  Fly   197 GKCC 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab6NP_001285869.1 Rab6 13..173 CDD:206654 68/160 (43%)
Rab35NP_001188678.1 Rab35 3..201 CDD:133310 78/199 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454186
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.