DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab6 and CG4789

DIOPT Version :9

Sequence 1:NP_001285869.1 Gene:Rab6 / 34636 FlyBaseID:FBgn0015797 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_573166.1 Gene:CG4789 / 32668 FlyBaseID:FBgn0030792 Length:274 Species:Drosophila melanogaster


Alignment Length:171 Identity:31/171 - (18%)
Similarity:61/171 - (35%) Gaps:48/171 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVR-----LQLWDTAGQ 71
            :.::|.:|:..||||||.....::........|:|.:...|.....:.|.|     ::|:|..|.
  Fly     6 RVRIVVVGDSGVGKTSLTHLITHNEALIRPGWTVGCNIQVKMHPFREGTARECPYFVELFDVGGS 70

  Fly    72 ERFRSLIPSYIRDSTVAVVVYDITNTNSFHQTSKWIDDVRTERGSD------------------- 117
            ...::....:.......::|:|:||..|..|...|:.::..:.|.|                   
  Fly    71 LNHKNTRSVFYAGIDGIILVHDLTNAKSQRQLIDWLYEIVNKEGKDTNKSNGASMPPSPPSPLSS 135

  Fly   118 ------------------------VIIMLVGNKTDLSDKRQ 134
                                    ..|:::|.|.||.|:::
  Fly   136 FSTDNLGTDGHILFDMEEFLGATQTPILVMGTKLDLLDEKR 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab6NP_001285869.1 Rab6 13..173 CDD:206654 31/170 (18%)
CG4789NP_573166.1 P-loop_NTPase 7..228 CDD:304359 31/170 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454187
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.