DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab6 and Rab9Fb

DIOPT Version :9

Sequence 1:NP_001285869.1 Gene:Rab6 / 34636 FlyBaseID:FBgn0015797 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_727472.1 Gene:Rab9Fb / 32029 FlyBaseID:FBgn0052670 Length:214 Species:Drosophila melanogaster


Alignment Length:220 Identity:80/220 - (36%)
Similarity:115/220 - (52%) Gaps:20/220 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQL 65
            ||..|:     .||::.||:..|||:.|:.||..:.|...:..|:|:||..:.:.|..|.|.||:
  Fly     1 MSQYDY-----LFKILVLGDIGVGKSCLLMRFSDNRFTEKHVCTVGMDFRVRNVELAGRMVMLQI 60

  Fly    66 WDTAGQERFRSLIPSYIRDSTVAVVVYDITNTNSFHQTSKWIDDVRTERGSDVIIMLVGNKTDLS 130
            |||||.|||:||:|||.|.:...::|||||::.||.....|:.::|......|.:||||||.|..
  Fly    61 WDTAGDERFKSLLPSYYRGAHGILLVYDITSSKSFRNIDGWLKEIRRMSSESVNVMLVGNKCDDL 125

  Fly   131 DKRQVSTEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAA------------LPGMDSTEN-- 181
            |.|||..|:|...|....:.|.|.|||:|.||..:|..::..            |.|...||:  
  Fly   126 DNRQVRMEQGFNYANHRALGFYEVSAKSGANVNDVFNMLSVGIYNRLVIHTPNRLSGGQETEDTA 190

  Fly   182 KPSEDMQEVVLKDSPNETKDPEGGC 206
            :|.::...:..||. ...||....|
  Fly   191 EPPDEPINLAGKDR-QRAKDSNTCC 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab6NP_001285869.1 Rab6 13..173 CDD:206654 67/171 (39%)
Rab9FbNP_727472.1 RAB 8..171 CDD:197555 67/162 (41%)
Rab 8..165 CDD:206640 67/156 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454173
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.