DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab6 and RabX2

DIOPT Version :9

Sequence 1:NP_001285869.1 Gene:Rab6 / 34636 FlyBaseID:FBgn0015797 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_572627.1 Gene:RabX2 / 31971 FlyBaseID:FBgn0030200 Length:195 Species:Drosophila melanogaster


Alignment Length:181 Identity:70/181 - (38%)
Similarity:104/181 - (57%) Gaps:4/181 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSL 77
            ||::.||:..|||:.|:.||..|.|...|..|:|||..::::.|..|.:.||:|||:|.:||.||
  Fly     8 FKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVMMLQVWDTSGDKRFNSL 72

  Fly    78 IPSYIRDSTVAVVVYDITNTNSFHQTSKWIDDVRTERGSDVIIMLVGNKTDLSDKRQVSTEEGER 142
            :||..|.:...::|||||::.||.....|:.::|......|.::|||||:|..:.||||.|:|..
  Fly    73 MPSNYRSAHGILLVYDITSSKSFQNIDGWMKEIRRMCPDKVTVLLVGNKSDDPNHRQVSMEQGFN 137

  Fly   143 KAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMDSTEN----KPSEDMQE 189
            .|....:.|.|.|||:|.||..:|..:|..:.......|    .|||..:|
  Fly   138 YAHRGALGFEEVSAKSGMNVYDIFSSLAMDIYHRYVLHNPISPMPSEQEEE 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab6NP_001285869.1 Rab6 13..173 CDD:206654 65/159 (41%)
RabX2NP_572627.1 RAB 8..171 CDD:197555 65/162 (40%)
Rab 8..165 CDD:206640 64/156 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454172
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.