DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab6 and Rab39

DIOPT Version :9

Sequence 1:NP_001285869.1 Gene:Rab6 / 34636 FlyBaseID:FBgn0015797 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001245568.1 Gene:Rab39 / 31684 FlyBaseID:FBgn0029959 Length:218 Species:Drosophila melanogaster


Alignment Length:200 Identity:73/200 - (36%)
Similarity:113/200 - (56%) Gaps:26/200 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRT-VRLQLWDTAGQERFR 75
            :|:|:.:|:.:|||:||:..|....|......|:|:||.::.:.::|.| ::|||||||||||||
  Fly     9 QFRLILIGDSTVGKSSLLKFFTDGKFAELSDPTVGVDFFARLIEMKDGTQIKLQLWDTAGQERFR 73

  Fly    76 SLIPSYIRDSTVAVVVYDITNTNSFHQTSKWIDDVRTERGSD---VIIMLVGNKTDL---SDKRQ 134
            |:..||.|:|...::||||:|..||.....|:  :..:|..:   .:..|||.|.||   ...|:
  Fly    74 SITKSYYRNSVGVLLVYDISNHASFEHIPLWM--MEAQRHIEPHRPVFALVGCKLDLINAGGHRE 136

  Fly   135 VSTEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMDSTENKPSEDMQEVVLKDSPNET 199
            |:|||.::.||:..:.|:||||::|.||::.||.|.                 |||..:....|.
  Fly   137 VTTEEAQKFAKQHGLHFVETSARSGANVEEAFRMVT-----------------QEVYARIRSGEY 184

  Fly   200 KDPEG 204
            |..:|
  Fly   185 KAEDG 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab6NP_001285869.1 Rab6 13..173 CDD:206654 67/166 (40%)
Rab39NP_001245568.1 Rab39 8..218 CDD:133311 72/199 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454181
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.