DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab6 and Rab6b

DIOPT Version :9

Sequence 1:NP_001285869.1 Gene:Rab6 / 34636 FlyBaseID:FBgn0015797 Length:208 Species:Drosophila melanogaster
Sequence 2:XP_006511799.1 Gene:Rab6b / 270192 MGIID:107283 Length:234 Species:Mus musculus


Alignment Length:186 Identity:155/186 - (83%)
Similarity:168/186 - (90%) Gaps:1/186 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTV 87
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse    50 VGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTV 114

  Fly    88 AVVVYDITNTNSFHQTSKWIDDVRTERGSDVIIMLVGNKTDLSDKRQVSTEEGERKAKELNVMFI 152
            |||||||||.|||.||||||||||||||||||||||||||||:||||::.||||::||||:||||
Mouse   115 AVVVYDITNLNSFQQTSKWIDDVRTERGSDVIIMLVGNKTDLADKRQITIEEGEQRAKELSVMFI 179

  Fly   153 ETSAKAGYNVKQLFRRVAAALPGMDSTENKPSEDMQEVVLKDSPNETKDPEGGCAC 208
            |||||.||||||||||||:|||||::.:.|..|.|.::.| |.|.|....||||:|
Mouse   180 ETSAKTGYNVKQLFRRVASALPGMENVQEKSKEGMIDIKL-DKPQEPPASEGGCSC 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab6NP_001285869.1 Rab6 13..173 CDD:206654 138/149 (93%)
Rab6bXP_006511799.1 Rab6 50..200 CDD:206654 138/149 (93%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0094
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 359 1.000 Inparanoid score I2201
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1277051at2759
OrthoFinder 1 1.000 - - FOG0000767
OrthoInspector 1 1.000 - - otm44161
orthoMCL 1 0.900 - - OOG6_100976
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X452
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.730

Return to query results.
Submit another query.