DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab6 and Rab7b

DIOPT Version :10

Sequence 1:NP_477172.1 Gene:Rab6 / 34636 FlyBaseID:FBgn0015797 Length:208 Species:Drosophila melanogaster
Sequence 2:XP_006529491.1 Gene:Rab7b / 226421 MGIID:2442295 Length:257 Species:Mus musculus


Alignment Length:42 Identity:12/42 - (28%)
Similarity:18/42 - (42%) Gaps:2/42 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QSEGAAVWAPTWADTLKKDLLKGYDPSIRPSQHYNVTTVETG 68
            :.|......||..:.:...||:..:..||  ..:||..|.||
Mouse   294 EPESLEALGPTSENLIVMVLLQEQNLGIR--YKFNVPIVRTG 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab6NP_477172.1 Rab6 13..173 CDD:206654 12/42 (29%)
Rab7bXP_006529491.1 Rab 67..227 CDD:206640
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.