Sequence 1: | NP_001285869.1 | Gene: | Rab6 / 34636 | FlyBaseID: | FBgn0015797 | Length: | 208 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_490735.3 | Gene: | W04C9.5 / 189184 | WormBaseID: | WBGene00021027 | Length: | 369 | Species: | Caenorhabditis elegans |
Alignment Length: | 198 | Identity: | 50/198 - (25%) |
---|---|---|---|
Similarity: | 89/198 - (44%) | Gaps: | 24/198 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 PLRKFKLVFLGEQSVGKTSLITRF------MYDSFDNTYQATIGIDFLSKTM--YLEDRTVRLQL 65
Fly 66 WDTAGQER--FRSLIPSYIRDSTVAVVVYDITNTNSFHQTSKWIDDV---RTERGSDVIIMLVGN 125
Fly 126 KTDLSDKRQVSTEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMDSTENKPSEDMQEV 190
Fly 191 VLK 193 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab6 | NP_001285869.1 | Rab6 | 13..173 | CDD:206654 | 45/172 (26%) |
W04C9.5 | NP_490735.3 | P-loop_NTPase | 171..333 | CDD:304359 | 45/172 (26%) |
Ras | 177..333 | CDD:278499 | 44/166 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |