DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab6 and W04C9.5

DIOPT Version :9

Sequence 1:NP_001285869.1 Gene:Rab6 / 34636 FlyBaseID:FBgn0015797 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_490735.3 Gene:W04C9.5 / 189184 WormBaseID:WBGene00021027 Length:369 Species:Caenorhabditis elegans


Alignment Length:198 Identity:50/198 - (25%)
Similarity:89/198 - (44%) Gaps:24/198 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PLRKFKLVFLGEQSVGKTSLITRF------MYDSFDNTYQATIGIDFLSKTM--YLEDRTVRLQL 65
            |::...|...|.::.||.:|::..      :...::|  ::..|.|..||||  .|.:..:.|::
 Worm   167 PMQHVVLRVYGSRNSGKKTLLSAINQFATRLVTQYNN--ESNEGDDTSSKTMNFLLNNEQIELEM 229

  Fly    66 WDTAGQER--FRSLIPSYIRDSTVAVVVYDITNTNSFHQTSKWIDDV---RTERGSDVIIMLVGN 125
            ...|..|.  |.|.:..|       .:||::.|..||...:..:..:   :..||:::|  |:||
 Worm   230 LLEATLENSPFASSLTMY-------AIVYNVDNRESFVCATDLLSRLLNRKIARGANII--LIGN 285

  Fly   126 KTDLSDKRQVSTEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMDSTENKPSEDMQEV 190
            |.||.....||..||...||.....|:|.||:...|:.:|:..:...|....:...:|:..|..:
 Worm   286 KIDLKRNTVVSKMEGACLAKVHKCNFVEVSAQYSMNISELWTIILKQLQAPKAELEEPNGWMHRI 350

  Fly   191 VLK 193
            |.:
 Worm   351 VTR 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab6NP_001285869.1 Rab6 13..173 CDD:206654 45/172 (26%)
W04C9.5NP_490735.3 P-loop_NTPase 171..333 CDD:304359 45/172 (26%)
Ras 177..333 CDD:278499 44/166 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.