DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab6 and rab-6.2

DIOPT Version :9

Sequence 1:NP_001285869.1 Gene:Rab6 / 34636 FlyBaseID:FBgn0015797 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_510790.1 Gene:rab-6.2 / 181759 WormBaseID:WBGene00004270 Length:205 Species:Caenorhabditis elegans


Alignment Length:218 Identity:176/218 - (80%)
Similarity:183/218 - (83%) Gaps:29/218 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTA 69
            ||||||:||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
 Worm     3 DFGNPLKKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTA 67

  Fly    70 GQERFRSLIPSYIRDSTVAVVVYDITNTNSFHQTSKWIDDVRTERGSDVIIMLVGNKTDLSDKRQ 134
            |||||||||||||||||||||||||||:|||||||||||||||||||||||||||||||||||||
 Worm    68 GQERFRSLIPSYIRDSTVAVVVYDITNSNSFHQTSKWIDDVRTERGSDVIIMLVGNKTDLSDKRQ 132

  Fly   135 VSTEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMDSTENKPSEDMQEVVLKDSPNE- 198
            |:|:||||||||||||||||||||||||||||||:|.||||               ::||.|.| 
 Worm   133 VTTDEGERKAKELNVMFIETSAKAGYNVKQLFRRIAGALPG---------------IIKDDPVEP 182

  Fly   199 ----TKDP---------EGGCAC 208
                |.||         ||.|.|
 Worm   183 PNVVTMDPIRQRQIVTDEGSCWC 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab6NP_001285869.1 Rab6 13..173 CDD:206654 154/159 (97%)
rab-6.2NP_510790.1 Rab6 11..171 CDD:206654 154/159 (97%)
RAB 11..168 CDD:197555 153/156 (98%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 305 1.000 Domainoid score I746
eggNOG 1 0.900 - - E1_KOG0094
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H134129
Inparanoid 1 1.050 333 1.000 Inparanoid score I1419
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53521
OrthoDB 1 1.010 - - D1277051at2759
OrthoFinder 1 1.000 - - FOG0000767
OrthoInspector 1 1.000 - - oto19242
orthoMCL 1 0.900 - - OOG6_100976
Panther 1 1.100 - - LDO PTHR24073
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1276
SonicParanoid 1 1.000 - - X452
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.870

Return to query results.
Submit another query.