DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab6 and rab-6.1

DIOPT Version :9

Sequence 1:NP_001285869.1 Gene:Rab6 / 34636 FlyBaseID:FBgn0015797 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_498993.1 Gene:rab-6.1 / 176275 WormBaseID:WBGene00004269 Length:205 Species:Caenorhabditis elegans


Alignment Length:208 Identity:158/208 - (75%)
Similarity:183/208 - (87%) Gaps:9/208 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DF-GNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDT 68
            || .|.|:||||||||||||||||:||||||||||||||||||||||||||||||||:|||||||
 Worm     3 DFTNNALKKFKLVFLGEQSVGKTSIITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTIRLQLWDT 67

  Fly    69 AGQERFRSLIPSYIRDSTVAVVVYDITNTNSFHQTSKWIDDVRTERGSDVIIMLVGNKTDLSDKR 133
            |||||||||||||||||:||||||||||.||||||:||:||||.|||.||||:||||||||:|||
 Worm    68 AGQERFRSLIPSYIRDSSVAVVVYDITNANSFHQTTKWVDDVRNERGCDVIIVLVGNKTDLADKR 132

  Fly   134 QVSTEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGM--DSTENKPSEDMQEVVLKDSP 196
            |||||:||:||::|||||||||||||||||||||::|.||||:  :.|..:|:     :|:.:.|
 Worm   133 QVSTEDGEKKARDLNVMFIETSAKAGYNVKQLFRKIATALPGIVQEETPEQPN-----IVIMNPP 192

  Fly   197 NETKDPEG-GCAC 208
            .:.::.:| .|.|
 Worm   193 KDAEESQGRQCPC 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab6NP_001285869.1 Rab6 13..173 CDD:206654 142/159 (89%)
rab-6.1NP_498993.1 Rab6 12..172 CDD:206654 142/159 (89%)
RAB 12..170 CDD:197555 141/157 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167284
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0094
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53521
OrthoDB 1 1.010 - - D1277051at2759
OrthoFinder 1 1.000 - - FOG0000767
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100976
Panther 1 1.100 - - LDO PTHR24073
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X452
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.760

Return to query results.
Submit another query.