DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab6 and rab41

DIOPT Version :9

Sequence 1:NP_001285869.1 Gene:Rab6 / 34636 FlyBaseID:FBgn0015797 Length:208 Species:Drosophila melanogaster
Sequence 2:XP_012823317.1 Gene:rab41 / 100124772 -ID:- Length:211 Species:Xenopus tropicalis


Alignment Length:212 Identity:179/212 - (84%)
Similarity:191/212 - (90%) Gaps:5/212 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSS---GDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRT-V 61
            |||   |:||||||||||||||||||||||||||||||||||||||||||||||||||||||| |
 Frog     1 MSSAGGGEFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTQV 65

  Fly    62 RLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNTNSFHQTSKWIDDVRTERGSDVIIMLVGNK 126
            |||||||||||||||||||||||||:|||||||||.|||.|||||||||||||||||||||||||
 Frog    66 RLQLWDTAGQERFRSLIPSYIRDSTIAVVVYDITNLNSFQQTSKWIDDVRTERGSDVIIMLVGNK 130

  Fly   127 TDLSDKRQVSTEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMDSTENKPSEDMQEVV 191
            |||:||||::|||||::||||:|||||||||.|||||||||||||||||||||..|..|||.::.
 Frog   131 TDLADKRQITTEEGEQRAKELSVMFIETSAKTGYNVKQLFRRVAAALPGMDSTPEKSKEDMIDIK 195

  Fly   192 LKDSPNETKDPEGGCAC 208
            | :.|.|....|.||:|
 Frog   196 L-EKPPEQPVTESGCSC 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab6NP_001285869.1 Rab6 13..173 CDD:206654 149/160 (93%)
rab41XP_012823317.1 Rab6 16..177 CDD:206654 149/160 (93%)
RAB 16..174 CDD:197555 146/157 (93%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 357 1.000 Inparanoid score I2176
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1277051at2759
OrthoFinder 1 1.000 - - FOG0000767
OrthoInspector 1 1.000 - - otm49338
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X452
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.