DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab6 and rab6b

DIOPT Version :9

Sequence 1:NP_001285869.1 Gene:Rab6 / 34636 FlyBaseID:FBgn0015797 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001090835.1 Gene:rab6b / 100038231 XenbaseID:XB-GENE-493829 Length:208 Species:Xenopus tropicalis


Alignment Length:207 Identity:174/207 - (84%)
Similarity:188/207 - (90%) Gaps:1/207 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLW 66
            :.|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
 Frog     3 AGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLW 67

  Fly    67 DTAGQERFRSLIPSYIRDSTVAVVVYDITNTNSFHQTSKWIDDVRTERGSDVIIMLVGNKTDLSD 131
            ||||||||||||||||||||||||||||||.||||||||||||||||||||||||||||||||:|
 Frog    68 DTAGQERFRSLIPSYIRDSTVAVVVYDITNLNSFHQTSKWIDDVRTERGSDVIIMLVGNKTDLAD 132

  Fly   132 KRQVSTEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMDSTENKPSEDMQEVVLKDSP 196
            |||::.|.||:|||||||||||||||.||||||||||||:|||||:.:|.|..:.|.::.| |.|
 Frog   133 KRQITIEAGEQKAKELNVMFIETSAKTGYNVKQLFRRVASALPGMECSEEKSKDGMIDIKL-DKP 196

  Fly   197 NETKDPEGGCAC 208
            .|.:..:.||:|
 Frog   197 QEPQVADAGCSC 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab6NP_001285869.1 Rab6 13..173 CDD:206654 150/159 (94%)
rab6bNP_001090835.1 Rab6 14..174 CDD:206654 150/159 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1277051at2759
OrthoFinder 1 1.000 - - FOG0000767
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X452
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.