DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Patsas and SWF1

DIOPT Version :9

Sequence 1:NP_001356957.1 Gene:Patsas / 34634 FlyBaseID:FBgn0029137 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_010411.1 Gene:SWF1 / 851704 SGDID:S000002533 Length:336 Species:Saccharomyces cerevisiae


Alignment Length:209 Identity:56/209 - (26%)
Similarity:84/209 - (40%) Gaps:72/209 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   431 YYRAIKQIPYFDKLKKRNVMLTRLCHSCRCLRPLRAKHCRVCNRCVSYFDHHCPFIYNCVGLRNR 495
            ||.|||                  |.:||.::|.|:|||.:|||||...||||.:|.||:|..|.
Yeast   130 YYPAIK------------------CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNY 176

  Fly   496 MWFFLFVLSVAVNCSFTIYFACYCVMIEGFTMLYVLGL----------IEAVVFCGLGWILTCTS 550
            :.|:||::|       .|:..||     .|..|:.:.|          :...:.||      |.:
Yeast   177 LQFYLFLIS-------NIFSMCY-----AFLRLWYISLNSTSTLPRAVLTLTILCG------CFT 223

  Fly   551 ILHACM----------NLTTNEMFNYKRYPYLRDKRGRYQNPFSRGPILNLLE------FFVCLP 599
            |:.|..          .:||||          :||....|.....|.::..|:      ||.|..
Yeast   224 IICAIFTYLQLAIVKEGMTTNE----------QDKWYTIQEYMREGKLVRSLDDDCPSWFFKCTE 278

  Fly   600 DRGDDNDLLLEDNI 613
            .:.|..:.|.:.::
Yeast   279 QKDDAAEPLQDQHV 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PatsasNP_001356957.1 ANKYR 113..306 CDD:223738
ANK repeat 148..181 CDD:293786
ANK repeat 187..214 CDD:293786
ANK repeat 216..247 CDD:293786
ANK repeat 249..280 CDD:293786
ANK repeat 282..314 CDD:293786
Ank_4 283..336 CDD:316185
DHHC 455..567 CDD:334580 41/131 (31%)
SWF1NP_010411.1 COG5273 22..336 CDD:227598 56/209 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22883
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.