Sequence 1: | NP_001356957.1 | Gene: | Patsas / 34634 | FlyBaseID: | FBgn0029137 | Length: | 613 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_177101.2 | Gene: | AT1G69420 / 843274 | AraportID: | AT1G69420 | Length: | 596 | Species: | Arabidopsis thaliana |
Alignment Length: | 197 | Identity: | 48/197 - (24%) |
---|---|---|---|
Similarity: | 76/197 - (38%) | Gaps: | 73/197 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 466 AKHCRVCNRCVSYFDHHCPFIYNCVGLRNRMWFFLFVLSVAVNCSFTIYFACYCVMIEGFTMLYV 530
Fly 531 L----------------------GLIEAVVFCGLGWILTCTSILHACMNLTTNEMFNY------- 566
Fly 567 --KRYPYLRDKRGRYQNPFSRG----PILNLLEFFV----------------CLPDRGDDNDLLL 609
Fly 610 ED 611 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Patsas | NP_001356957.1 | ANKYR | 113..306 | CDD:223738 | |
ANK repeat | 148..181 | CDD:293786 | |||
ANK repeat | 187..214 | CDD:293786 | |||
ANK repeat | 216..247 | CDD:293786 | |||
ANK repeat | 249..280 | CDD:293786 | |||
ANK repeat | 282..314 | CDD:293786 | |||
Ank_4 | 283..336 | CDD:316185 | |||
DHHC | 455..567 | CDD:334580 | 34/131 (26%) | ||
AT1G69420 | NP_177101.2 | zf-DHHC | 164..296 | CDD:279823 | 35/136 (26%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |