DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Patsas and zdhhc12

DIOPT Version :9

Sequence 1:NP_001356957.1 Gene:Patsas / 34634 FlyBaseID:FBgn0029137 Length:613 Species:Drosophila melanogaster
Sequence 2:XP_012825930.1 Gene:zdhhc12 / 550061 XenbaseID:XB-GENE-1216126 Length:276 Species:Xenopus tropicalis


Alignment Length:276 Identity:76/276 - (27%)
Similarity:113/276 - (40%) Gaps:70/276 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   364 SKGPLFLFLFSVLLWGYPMYMIRAIPITWNILRRSHYCFI----------YWNAVMWISWAI--- 415
            |.|.|...:.:||.||..:.:         .|..:...||          .|..:..:|:.:   
 Frog     7 SAGFLVRTVHTVLTWGVTLVL---------FLHDTDIFFICHSDLYHQENQWKLLQPLSFGLLVL 62

  Fly   416 --------ANRRDPGYI-------PLSSDAYYRAIKQIPYFDKLKKRNVMLTRLCHSCRCLRPLR 465
                    .:..||||:       ||.:  |......||     :..:.|..|.|..|...:|:|
 Frog    63 CSVLLYFAVSLMDPGYVLSDCNKKPLPT--YLEQGVMIP-----EAPSGMRLRRCGYCLLQQPIR 120

  Fly   466 AKHCRVCNRCVSYFDHHCPFIYNCVGLRNRMWFFLFVLSVAVNCSFTIYFACYCVMIEGFTM--- 527
            |:||:.|:.||..||||||:|.||||.||...|.|:     :...|.:....:.:...||..   
 Frog   121 ARHCKTCHHCVRRFDHHCPWIENCVGERNHPLFMLY-----LGVQFLVLLWAFRLTWSGFQFEAS 180

  Fly   528 ----LYV-LGLIEAVVFCGL-----GWILTCTSILHACMNLTTNEMFNYKRYPYLRDKRGRYQ-- 580
                |.| :.|:.|.:..|:     ..:|.|...|.:| |:||.|..::.|..||:    .|.  
 Frog   181 WTEWLKVNIFLLLAFILTGIFTFVVALLLGCHCYLISC-NVTTWEFMSHHRISYLK----HYDSD 240

  Fly   581 -NPFSRGPILNLLEFF 595
             |||.:|...||.:||
 Frog   241 TNPFDKGIARNLWDFF 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PatsasNP_001356957.1 ANKYR 113..306 CDD:223738
ANK repeat 148..181 CDD:293786
ANK repeat 187..214 CDD:293786
ANK repeat 216..247 CDD:293786
ANK repeat 249..280 CDD:293786
ANK repeat 282..314 CDD:293786
Ank_4 283..336 CDD:316185
DHHC 455..567 CDD:334580 41/124 (33%)
zdhhc12XP_012825930.1 DHHC 105..228 CDD:366691 43/128 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.