DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Patsas and zdhhc3a

DIOPT Version :9

Sequence 1:NP_001356957.1 Gene:Patsas / 34634 FlyBaseID:FBgn0029137 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_001002725.1 Gene:zdhhc3a / 436998 ZFINID:ZDB-GENE-040718-484 Length:316 Species:Danio rerio


Alignment Length:277 Identity:62/277 - (22%)
Similarity:114/277 - (41%) Gaps:67/277 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   309 DLEPRDKNGKTPIMLAQAHQHQDVVRLLYGEVKKKSRWIPSVSESWG-------WLFGGAGDSKG 366
            |:|.:....:.|..|...|:.|:            |.|.  :.::.|       |          
Zfish    10 DVERQASGLQPPQCLPSCHERQN------------SMWF--IKDACGIVCAIITW---------- 50

  Fly   367 PLFLFLFS--VLLWGYPMYMIRAIPITWNILRRSHYCFIYWNAVMWISWAIANR---RDPGYIPL 426
              ||..|:  |:|:   :.:|.:..:|::::..:     .:|::.:::.|...|   .|||.:|.
Zfish    51 --FLVFFAEFVVLF---VMLIPSKNLTYSLVNGT-----LFNSLAFLALASHFRAMCTDPGAVPK 105

  Fly   427 SSDAYYRAIKQIPYFDKLKKRNVMLTRLCHSCRCLRPLRAKHCRVCNRCVSYFDHHCPFIYNCVG 491
            .:     |.|:  |.:.|:.:...:...|..|..::|.||.||.||.||:...|||||::.||||
Zfish   106 GN-----ATKE--YIESLQLKPGQVVYKCPKCCSIKPDRAHHCSVCKRCIRKMDHHCPWVNNCVG 163

  Fly   492 LRNRMWFFLFVLSVA--------------VNCSFTIYFACYCVMIEGFTMLYVLGLIEAVVFCGL 542
            ..|:.:|.||.:.:.              :||....:..|.........:|.:|...|.::|...
Zfish   164 ENNQKYFVLFTMYICLISLHSLVMVVFHFLNCFEDDWTKCSTFSPPATVILLILLCFEGLLFLIF 228

  Fly   543 GWILTCTSILHACMNLT 559
            ..::..|.:...|.:.|
Zfish   229 TSVMFGTQVHSICTDET 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PatsasNP_001356957.1 ANKYR 113..306 CDD:223738
ANK repeat 148..181 CDD:293786
ANK repeat 187..214 CDD:293786
ANK repeat 216..247 CDD:293786
ANK repeat 249..280 CDD:293786
ANK repeat 282..314 CDD:293786 2/4 (50%)
Ank_4 283..336 CDD:316185 6/26 (23%)
DHHC 455..567 CDD:334580 34/119 (29%)
zdhhc3aNP_001002725.1 zf-DHHC 127..251 CDD:279823 34/119 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.