DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Patsas and CG17196

DIOPT Version :9

Sequence 1:NP_001356957.1 Gene:Patsas / 34634 FlyBaseID:FBgn0029137 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_651426.1 Gene:CG17196 / 43112 FlyBaseID:FBgn0039368 Length:276 Species:Drosophila melanogaster


Alignment Length:222 Identity:56/222 - (25%)
Similarity:82/222 - (36%) Gaps:65/222 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   380 YPMYMIRAIPITWNILRRSHYCFIYWNAVMWISWAIANRRDPGYIPLSSDAYYR---AIKQIPYF 441
            |..::|.||..|:|||.....|                              ||   |:|.:|..
  Fly    56 YKFFVISAIFTTYNILGNLLAC------------------------------YRTSSAVKSLPQE 90

  Fly   442 DKLKKRNV-MLTRLCHSCRCLRPLRAKHCRVCNRCVSYFDHHCPFIYNCVGLRNRMWFFLFVLSV 505
            .::.|... .|...|..|:.|.|.|:.||.:|..|:...||||.|...|:|..|..:||.....:
  Fly    91 RQIPKPGTEHLWHYCDICQKLMPPRSWHCALCKCCILKRDHHCIFAATCIGHNNHRYFFWLTFYL 155

  Fly   506 AVNCSFTIYFACYCVMIEGFTMLYVLGLIEAVVFCGLGWILTCTSILHACMNLTTNEMFNYKRYP 570
            |    |.|:.:...:.::.....|:|..::|    |.|               .|.:..:|.||.
  Fly   156 A----FGIFMSMATLFVDVGRSFYLLHRMKA----GFG---------------NTVKSLSYFRYV 197

  Fly   571 YLRDKRGRYQNPFSRG-PILNLLEFFV 596
            .|      ..|.|:.| |.| :|.|.|
  Fly   198 CL------ILNIFALGFPAL-MLRFQV 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PatsasNP_001356957.1 ANKYR 113..306 CDD:223738
ANK repeat 148..181 CDD:293786
ANK repeat 187..214 CDD:293786
ANK repeat 216..247 CDD:293786
ANK repeat 249..280 CDD:293786
ANK repeat 282..314 CDD:293786
Ank_4 283..336 CDD:316185
DHHC 455..567 CDD:334580 28/111 (25%)
CG17196NP_651426.1 zf-DHHC 103..228 CDD:279823 40/145 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467582
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.