DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Patsas and CG13029

DIOPT Version :9

Sequence 1:NP_001356957.1 Gene:Patsas / 34634 FlyBaseID:FBgn0029137 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster


Alignment Length:262 Identity:61/262 - (23%)
Similarity:101/262 - (38%) Gaps:61/262 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   369 FLFLFSVLLWGYPM-YMIRAIPITWNILRRSHYCFIYWNAVMWISWAI------ANRRDPGYIPL 426
            |:.:.:||.:...| ||:..|..|..:..:     |.|...::|.:.:      .:|.......|
  Fly    30 FVLVGTVLFFSVEMFYMLPRIYDTDGLFFK-----IAWLMALFIVYNLLGNMLACHRNSSAVTSL 89

  Fly   427 SSDAYYRAIKQIPYFDKLKKRNVMLTRLCHSCRCLRPLRAKHCRVCNRCVSYFDHHCPFIYNCVG 491
            ..|      :|||..::..     |...|..|:.|.|.|:.||:||..|:...||||.|...|||
  Fly    90 PKD------RQIPCPEEKH-----LWHFCDHCQMLVPPRSWHCKVCECCILRRDHHCIFTATCVG 143

  Fly   492 LRNRMWFFLF--------VLSVAVNCSFTI------------YFACYCVMIEGFTMLYV---LGL 533
            ..|..:||.|        :||:|.:.:..|            :|:.:.:.::..:...:   :..
  Fly   144 HTNYRYFFWFTVYMHIGSLLSLATHVNLLIIDEQIRRQYVVLHFSRFFLFLKPMSCELIALNISF 208

  Fly   534 IEAVVFCGLGWILTCTSILHACMNLTTNEMFNYKRYPY----------LRDKRG--RYQNPFSRG 586
            |..:..|.|..|:....|....:|.|   .:..|.|.|          ...|||  .:.:|..|.
  Fly   209 IINIYACILSLIMLGYQIPALYLNTT---FYTPKDYRYNQGLLGNFMAFMGKRGLWTFISPSIRS 270

  Fly   587 PI 588
            |:
  Fly   271 PL 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PatsasNP_001356957.1 ANKYR 113..306 CDD:223738
ANK repeat 148..181 CDD:293786
ANK repeat 187..214 CDD:293786
ANK repeat 216..247 CDD:293786
ANK repeat 249..280 CDD:293786
ANK repeat 282..314 CDD:293786
Ank_4 283..336 CDD:316185
DHHC 455..567 CDD:334580 34/134 (25%)
CG13029NP_648928.1 zf-DHHC 100..236 CDD:279823 35/143 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467585
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.