DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Patsas and CG4483

DIOPT Version :9

Sequence 1:NP_001356957.1 Gene:Patsas / 34634 FlyBaseID:FBgn0029137 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster


Alignment Length:271 Identity:66/271 - (24%)
Similarity:108/271 - (39%) Gaps:68/271 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   378 WGYPMYMIRAIPITWNILRRSHYCFIYW-----------NAVMWI-------SWAIANRRDPGYI 424
            ||....:...:.:||.::   |...::|           .|::||       ::..:....||::
  Fly    15 WGPITLLTLTLIVTWTVI---HMNSMWWAPGSSLESVLNYALIWIQTFGTLYNFIRSLMVGPGFV 76

  Fly   425 PLSSDAYYRAIKQIPYFDKLKKRNVMLTRLCHSCRCLRPLRAKHCRVCNRCVSYFDHHCPFIYNC 489
            ||         |..|...|.|    |..:.|..|...:..|:.|||.|||||...|||||:|..|
  Fly    77 PL---------KWHPQLTKDK----MFLQFCTRCNGYKAPRSHHCRRCNRCVMKMDHHCPWINTC 128

  Fly   490 VGLRNR---MWFFLFVLSVAVNCSFTIYFACYCVMIEGFTMLYVL---------------GLIEA 536
            ||..|:   ::|.||.:|.:::....|..|    :|.|....:::               .|:..
  Fly   129 VGWSNQDSFVYFLLFFMSGSIHGGIIIVSA----VIRGIKKRWLIRYGLRHMATVHLTQTNLLAC 189

  Fly   537 VVFCG--LGWILTCTSILHACM-----NLTTNEMFNYKRYPYLRDKRGR-----YQNPFSRGPIL 589
            |...|  :|.:|....:|:..|     |.|..|.:..|:..:.|:...|     :..|::.|...
  Fly   190 VFSLGVIMGTVLASIKLLYMQMKSILKNQTEIENWIVKKAAFRRNAYPRKGIKPFVYPYNLGWKT 254

  Fly   590 NLLEFFVCLPD 600
            |:.|.|....|
  Fly   255 NMREVFFSTGD 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PatsasNP_001356957.1 ANKYR 113..306 CDD:223738
ANK repeat 148..181 CDD:293786
ANK repeat 187..214 CDD:293786
ANK repeat 216..247 CDD:293786
ANK repeat 249..280 CDD:293786
ANK repeat 282..314 CDD:293786
Ank_4 283..336 CDD:316185
DHHC 455..567 CDD:334580 39/136 (29%)
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 41/143 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467529
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.