DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Patsas and CG17287

DIOPT Version :9

Sequence 1:NP_001356957.1 Gene:Patsas / 34634 FlyBaseID:FBgn0029137 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster


Alignment Length:317 Identity:78/317 - (24%)
Similarity:114/317 - (35%) Gaps:102/317 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   345 RWIPSVSESWGWLFGGAGDSKGPLFLFLFSVLLWGYPMYMIRAIPITWNILRRSHY------CFI 403
            ||:|:                    |.:...|:|.|.:::.:..     |.:.|.|      .|.
  Fly    17 RWLPA--------------------LIILGFLVWSYHVFVYQIC-----IKKVSDYLTIGLLLFF 56

  Fly   404 YWNAVMWISWA------IANRRDPGYIPLSSDAYYRAIKQIPYFDKLKK---------------R 447
            |...:....|.      :|..|.|....:|.:.          .||||:               |
  Fly    57 YHLLLFMFLWTWFRCIFVAPVRIPDQWKISPED----------VDKLKRNDGIEGASRVLNYAAR 111

  Fly   448 NVM--------LTRLCHSCRCLRPLRAKHCRVCNRCVSYFDHHCPFIYNCVGLRNRMWFFLFVLS 504
            |:.        |.|.|.:|..::|.||.|||.|:.||...|||||:|.|||...|..:|.||:..
  Fly   112 NLPIATCTIDGLVRYCKTCWIIKPDRAHHCRTCHMCVLKMDHHCPWIVNCVHFHNFKYFILFLFY 176

  Fly   505 VAVNCSFTIYFACYCVMIE------GFTML--------YVLGLIEAVVFCGLGWILTCTSILHAC 555
            ..|.|     |..:|||:.      ||.:.        .:|..:..::|.....|:...|:|:..
  Fly   177 AEVYC-----FYLFCVMVYDLYLICGFEVTALKNQHSWNILQYLVCILFNIFTVIMYTVSLLNVS 236

  Fly   556 MNLTTNEMFNYKRYPYLRDKRGRYQNPFSRGPILNLLEF---------FVCLPDRGD 603
            .|.||.|. .|..|..|   .|:..|.|:.|..:|..:.         |.....|||
  Fly   237 RNRTTMES-AYATYFLL---GGKNNNGFNLGYFVNFRDLYGDKWYLWPFPIFSSRGD 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PatsasNP_001356957.1 ANKYR 113..306 CDD:223738
ANK repeat 148..181 CDD:293786
ANK repeat 187..214 CDD:293786
ANK repeat 216..247 CDD:293786
ANK repeat 249..280 CDD:293786
ANK repeat 282..314 CDD:293786
Ank_4 283..336 CDD:316185
DHHC 455..567 CDD:334580 41/125 (33%)
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 41/122 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467501
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.