DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Patsas and CG4676

DIOPT Version :9

Sequence 1:NP_001356957.1 Gene:Patsas / 34634 FlyBaseID:FBgn0029137 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster


Alignment Length:156 Identity:44/156 - (28%)
Similarity:64/156 - (41%) Gaps:48/156 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   372 LFSV------LLWGYPMYMIRAIPITWNILRRSHYCFIYWNAVMWISWAIANRRDPGYIPLSSDA 430
            ||::      |||...:::|  ..||.|:|           |.|.:..:|  |::....||.:  
  Fly    43 LFAIGGIWYTLLWLASLFLI--FNITSNML-----------ACMLVDTSI--RKELLKPPLDA-- 90

  Fly   431 YYRAIKQIPYFDKLKKRNVMLTR--LCHSCRCLRPLRAKHCRVCNRCVSYFDHHCPFIYNCVGLR 493
                              ..|.|  .|..|:.|.|.|:.||.|||.||...||||.|...|:|..
  Fly    91 ------------------AQLARWHSCQDCQTLVPPRSWHCEVCNVCVLKRDHHCRFTCCCIGHH 137

  Fly   494 NRMWFFLFVL-----SVAVNCSFTIY 514
            |..:||.:::     |:|.....:||
  Fly   138 NYRYFFYYLVYMIIGSLAAAIMESIY 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PatsasNP_001356957.1 ANKYR 113..306 CDD:223738
ANK repeat 148..181 CDD:293786
ANK repeat 187..214 CDD:293786
ANK repeat 216..247 CDD:293786
ANK repeat 249..280 CDD:293786
ANK repeat 282..314 CDD:293786
Ank_4 283..336 CDD:316185
DHHC 455..567 CDD:334580 26/65 (40%)
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 26/65 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467583
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.