DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Patsas and spe-10

DIOPT Version :9

Sequence 1:NP_001356957.1 Gene:Patsas / 34634 FlyBaseID:FBgn0029137 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_001021339.1 Gene:spe-10 / 3565514 WormBaseID:WBGene00004964 Length:351 Species:Caenorhabditis elegans


Alignment Length:263 Identity:58/263 - (22%)
Similarity:100/263 - (38%) Gaps:77/263 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   355 GWLFGGAGDSKGPLFLFLFSVLLWGYPMYMIRAIPITWNI---LRRSHYCFIYWNAVMWISWAIA 416
            ||:.....:    :.||:..:||| :.:||...:.|.:.:   ::.:.|..:.....:...|::|
 Worm    22 GWILTRCLN----VLLFIQLILLW-WSLYMYVTVTIGYYVQSTIQATIYLIVGSFLFVMSMWSLA 81

  Fly   417 NR--RDPGYIPLSSDAYYRAIKQIPYFDKLK---------------------KRNVMLTRLCHSC 458
            ..  ...|.:|    ..||..|::.  |:||                     ::|.:|..:|..|
 Worm    82 KTLFTRVGRVP----ERYRPSKELE--DRLKAVTPMEKNRYVVEKSTPEQLAQQNTILEEMCTYC 140

  Fly   459 R-----------------C--LRPLRAKHCRVCNRCVSYFDHHCPFIYNCVGLRNRMWFFLFVLS 504
            :                 |  ::|.||:||..|.:|...:|||||:|..||...|..:|.|::  
 Worm   141 KVVVAECDQVGRLKYCYECGHIKPDRARHCSSCGKCCIKYDHHCPWINMCVTHVNYKYFLLYI-- 203

  Fly   505 VAVNCSFTIYFACYCVMIEGFTMLYVLGLIEAVV--FCGLGWILTCTSILHACMNLTTNEMFNYK 567
              :..||.:|:             |:|..:|..|  |....|.......|....:.....:|.| 
 Worm   204 --IYTSFLVYW-------------YLLTSLEGAVRYFINQQWTDELGKFLFYLFSFIVGGVFGY- 252

  Fly   568 RYP 570
             ||
 Worm   253 -YP 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PatsasNP_001356957.1 ANKYR 113..306 CDD:223738
ANK repeat 148..181 CDD:293786
ANK repeat 187..214 CDD:293786
ANK repeat 216..247 CDD:293786
ANK repeat 249..280 CDD:293786
ANK repeat 282..314 CDD:293786
Ank_4 283..336 CDD:316185
DHHC 455..567 CDD:334580 32/132 (24%)
spe-10NP_001021339.1 zf-DHHC 151..277 CDD:279823 33/123 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.