Sequence 1: | NP_001356957.1 | Gene: | Patsas / 34634 | FlyBaseID: | FBgn0029137 | Length: | 613 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_840089.2 | Gene: | zdhhc8b / 352941 | ZFINID: | ZDB-GENE-030407-3 | Length: | 751 | Species: | Danio rerio |
Alignment Length: | 211 | Identity: | 62/211 - (29%) |
---|---|---|---|
Similarity: | 102/211 - (48%) | Gaps: | 54/211 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 405 WNAVMWI----SWAIANRRDPGYIPLS-----SDAYYRAIKQIPYFDKLKKRNVML-TRLCHSCR 459
Fly 460 CLRPLRAKHCRVCNRCVSYFDHHCPFIYNCVGLRNRMWFFLFVLSVAVNCSFTIYFACYCVMIEG 524
Fly 525 FTMLYVLGLIEA----------VVFC--GLGWI----LTCTSILHACMNLTTNEMFNYKRYPYLR 573
Fly 574 DKRGRYQ---NPFSRG 586 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Patsas | NP_001356957.1 | ANKYR | 113..306 | CDD:223738 | |
ANK repeat | 148..181 | CDD:293786 | |||
ANK repeat | 187..214 | CDD:293786 | |||
ANK repeat | 216..247 | CDD:293786 | |||
ANK repeat | 249..280 | CDD:293786 | |||
ANK repeat | 282..314 | CDD:293786 | |||
Ank_4 | 283..336 | CDD:316185 | |||
DHHC | 455..567 | CDD:334580 | 46/127 (36%) | ||
zdhhc8b | NP_840089.2 | zf-DHHC | 99..224 | CDD:279823 | 46/145 (32%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 293..346 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 437..461 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 633..659 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 666..685 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 703..736 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |