DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Patsas and CG17075

DIOPT Version :9

Sequence 1:NP_001356957.1 Gene:Patsas / 34634 FlyBaseID:FBgn0029137 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster


Alignment Length:301 Identity:73/301 - (24%)
Similarity:121/301 - (40%) Gaps:67/301 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 AYKGHADLMRLLMYSGVELQKTDNFGSTPLHLACLSGNMTCVR----LLCEKSQLDLEPRD--KN 316
            ||...::...::..|...|  |::...:|     ..|.:|.||    |..|.|..::.|.:  :.
  Fly    15 AYGVRSETDHIITISTAGL--TESHSESP-----AKGVVTPVRKPHSLGSEDSPENIIPGEQAET 72

  Fly   317 GKTPIMLAQAHQHQDVVRLLYGEVKKKSRWIPSVS------ESWGWLFGGAGDSKGPLFLFLFSV 375
            .|.|:.|.:..|.......:.....:|.|.:..:.      :.:|||.                :
  Fly    73 NKKPLHLCRLSQLVSYQSNIADVQHRKGRRLHGLQLPLHPLQIFGWLV----------------L 121

  Fly   376 LLWGYPMYMIRAIPITWNILRRSHYCFIYWNAVMWI-SWAIANRRDPGYIPLSSDAYYRAIKQ-- 437
            ||:|...|.: .||.....::...|..|....::.| |...|...||      :|...|.:.:  
  Fly   122 LLFGVASYWV-LIPAFHARIQGPLYGLITGLYLVHIASHLTALLTDP------ADKELRRVHRND 179

  Fly   438 --IPYFDKLKKRNVMLTRLCHSCRCLRPL--RAKHCRVCNRCVSYFDHHCPFIYNCVGLRNRMWF 498
              :|.||:.|..:|:....||.|. :|..  |.|||.|||:||..|||||.::.:|:|.||.:.|
  Fly   180 RIVPEFDRSKHSHVIENGRCHLCN-IRTSSNRTKHCSVCNKCVGKFDHHCKWLNHCIGSRNYVAF 243

  Fly   499 FLFVLSVAVNCSFTIYFACYCVMIEGFTMLYVLGLIEAVVF 539
            .:.|:|..|                 .|::.|..::..:||
  Fly   244 LMCVVSAVV-----------------ATLVIVAAVVAQIVF 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PatsasNP_001356957.1 ANKYR 113..306 CDD:223738 12/51 (24%)
ANK repeat 148..181 CDD:293786
ANK repeat 187..214 CDD:293786
ANK repeat 216..247 CDD:293786
ANK repeat 249..280 CDD:293786 4/21 (19%)
ANK repeat 282..314 CDD:293786 9/35 (26%)
Ank_4 283..336 CDD:316185 13/58 (22%)
DHHC 455..567 CDD:334580 30/87 (34%)
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 30/87 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.