DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Patsas and Zdhhc4

DIOPT Version :9

Sequence 1:NP_001356957.1 Gene:Patsas / 34634 FlyBaseID:FBgn0029137 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_001013141.1 Gene:Zdhhc4 / 304291 RGDID:1308389 Length:343 Species:Rattus norvegicus


Alignment Length:208 Identity:55/208 - (26%)
Similarity:90/208 - (43%) Gaps:56/208 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   444 LKKRNVML--------------TRLCHSCRCLRPLRAKHCRVCNRCVSYFDHHCPFIYNCVGLRN 494
            :.|.||:|              ...|.:|...:|.|:||||||:|||..|||||.::.||:|..|
  Rat   126 ITKTNVLLLLQVYEFDEVMFPKNSRCSTCDLRKPARSKHCRVCDRCVHRFDHHCVWVNNCIGAWN 190

  Fly   495 RMWFFLFVLSVAVN-CSFTIYFACYCVMIEGFTMLYV------LGLIEAV--------------- 537
            ..:|.:::|::..: .:..|..|.:.:.:...:.||.      ||..:||               
  Rat   191 TGYFLIYLLTLTASAATIAILSAAFLLRLVAVSNLYQETYLDDLGRFQAVDTGFLIQHLFLAFPR 255

  Fly   538 -VFCGLGWILT---------CTSILHACMNLTTNEMFN-----YKRYPYLRDKRGR----YQNPF 583
             :|. ||:::.         |.::..|..|.||||.:.     .:.:|.:......    :||.:
  Rat   256 IIFL-LGFVIVLSLLLAGYLCFALYLAATNQTTNEWYRGDWAWCQHWPLVAWSPSAEPQIHQNIY 319

  Fly   584 SRGPILNLLEFFV 596
            |.|...||.|.|:
  Rat   320 SHGLWSNLQEVFI 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PatsasNP_001356957.1 ANKYR 113..306 CDD:223738
ANK repeat 148..181 CDD:293786
ANK repeat 187..214 CDD:293786
ANK repeat 216..247 CDD:293786
ANK repeat 249..280 CDD:293786
ANK repeat 282..314 CDD:293786
Ank_4 283..336 CDD:316185
DHHC 455..567 CDD:334580 42/148 (28%)
Zdhhc4NP_001013141.1 zf-DHHC 151..292 CDD:279823 42/141 (30%)
Di-lysine motif. /evidence=ECO:0000250|UniProtKB:Q9NPG8 340..343
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D445686at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.