DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Patsas and Zdhhc1

DIOPT Version :9

Sequence 1:NP_001356957.1 Gene:Patsas / 34634 FlyBaseID:FBgn0029137 Length:613 Species:Drosophila melanogaster
Sequence 2:XP_008770707.1 Gene:Zdhhc1 / 291967 RGDID:1589775 Length:502 Species:Rattus norvegicus


Alignment Length:287 Identity:72/287 - (25%)
Similarity:105/287 - (36%) Gaps:100/287 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 LYGEVKKKSRWIPSVSESW--------GWLFGGAGDSKGPLFLFLFSVLLWGYPMYMIRAIPITW 392
            |.|:..:::.|      ||        .||          |:|| |:|:.:|   .::..:|..|
  Rat    31 LQGQRSRRNGW------SWPPHPLQIVAWL----------LYLF-FAVIGFG---VLVPLLPHHW 75

  Fly   393 NILRRSHYCF---------IYWNAVMWISWAIANRRDPGYI-PLSSDAYYRAIKQIPYFDKLKKR 447
              :...:.|.         ::..||. |..|.||.||..|. ||            |.|::.:..
  Rat    76 --VPAGYACMGAIFAGHLVVHLTAVS-IDPADANVRDKSYSGPL------------PIFNRSQHA 125

  Fly   448 NVMLTRLCHSCRCLRPLRAKHCRVCNRCVSYFDHHCPFIYNCVGLRNRMWFFLFVLSVAVNCSFT 512
            :|:....|:.|......|:|||..||:||..|||||.::.||||.||...|...|.|..:.....
  Rat   126 HVIEDLHCNLCDVDVSARSKHCSACNKCVCGFDHHCKWLNNCVGERNYRLFLHSVASALLGVLLL 190

  Fly   513 IYFACYCVMIEGF------------------------------------------TMLYVLGLIE 535
            :..|.| |.:|.|                                          .:|.:|||:.
  Rat   191 VLVATY-VFVEFFVNPMRLRTNQHFEVLKNHTDVWFVFLPAAPVETQAPAILALAALLILLGLLS 254

  Fly   536 AVVFCGLGWILTCTSILHACMNLTTNE 562
            ..:   ||.:| |..|......|||.|
  Rat   255 TAL---LGHLL-CFHIYLMWHKLTTYE 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PatsasNP_001356957.1 ANKYR 113..306 CDD:223738
ANK repeat 148..181 CDD:293786
ANK repeat 187..214 CDD:293786
ANK repeat 216..247 CDD:293786
ANK repeat 249..280 CDD:293786
ANK repeat 282..314 CDD:293786
Ank_4 283..336 CDD:316185 72/287 (25%)
DHHC 455..567 CDD:334580 42/150 (28%)
Zdhhc1XP_008770707.1 DHHC 126..281 CDD:396215 43/157 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.