DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Patsas and erf2

DIOPT Version :9

Sequence 1:NP_001356957.1 Gene:Patsas / 34634 FlyBaseID:FBgn0029137 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_595766.1 Gene:erf2 / 2541058 PomBaseID:SPBC3H7.09 Length:350 Species:Schizosaccharomyces pombe


Alignment Length:272 Identity:73/272 - (26%)
Similarity:112/272 - (41%) Gaps:71/272 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 GPLFLFLFSVL-LWGYPMYMIRAIPITWNILRRSHYCFIYWNAVMWISWAIANRRDPGYIPLSSD 429
            |.|| |:||.. ||   .::..|:|||          |.|..|:..:|....:..|||.:|  .:
pombe    98 GVLF-FIFSAFWLW---HHVSPAVPIT----------FAYLYALAVVSMFKCSTADPGILP--RN 146

  Fly   430 AYYRAIKQI-PYFDKLKKRNVML-----------TRLCHSCRCLRPLRAKHCRVCNRCVSYFDHH 482
            ||....... |:....:.|.|::           |..||:|...||.||.||.:|:.||.|.|||
pombe   147 AYSLTYNPAHPWSVIPEDRKVLVGSTRSDSVFVNTVYCHTCHLYRPPRASHCHLCDNCVEYLDHH 211

  Fly   483 CPFIYNCVGLRNRMWFFLFVLSVAVNCSFTIYFACYCVMIEGFTML------------------- 528
            |.::..|:|.||..::|:|:|||.::       |.|...:..:|.:                   
pombe   212 CIWLNTCIGRRNYRYYFIFLLSVVLS-------ALYLTGLGFYTSIGSFHESTDTNFAAHLRRPW 269

  Fly   529 ----YVLGLIEAVVFCGLGWILTCTSILHACMNLTTNEMFNYKRYPYLRDKRGRYQ--NPFSRGP 587
                :.||     ::..||.||......:.|..::..:    ..:.|||.|....:  :||....
pombe   270 AGVSFFLG-----IYGALGAILPGILFCYQCYLISVGQ----NVHEYLRAKSTETEDVHPFHDSI 325

  Fly   588 ILNLLEFFVCLP 599
            .||.| ..:|.|
pombe   326 WLNFL-VVLCRP 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PatsasNP_001356957.1 ANKYR 113..306 CDD:223738
ANK repeat 148..181 CDD:293786
ANK repeat 187..214 CDD:293786
ANK repeat 216..247 CDD:293786
ANK repeat 249..280 CDD:293786
ANK repeat 282..314 CDD:293786
Ank_4 283..336 CDD:316185
DHHC 455..567 CDD:334580 36/134 (27%)
erf2NP_595766.1 COG5273 57..350 CDD:227598 73/272 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.