Sequence 1: | NP_001356957.1 | Gene: | Patsas / 34634 | FlyBaseID: | FBgn0029137 | Length: | 613 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_492753.2 | Gene: | dhhc-12 / 186602 | WormBaseID: | WBGene00010323 | Length: | 310 | Species: | Caenorhabditis elegans |
Alignment Length: | 260 | Identity: | 60/260 - (23%) |
---|---|---|---|
Similarity: | 89/260 - (34%) | Gaps: | 81/260 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 334 RLLYGEVKKK----SRWIP----SVSESWGWLFGGAGDSKGPLFLFLFSVLLWGYPMYMI-RAIP 389
Fly 390 ITWN--------ILRRSHYCFIYWNAVMWISWAIANRRDPGYIPLSSDAYYRAIKQIPYFDKLKK 446
Fly 447 RNVMLTRLCHSCRCLRPLRAKHCRVCNRCVSYFDHHCPFIYNCVGLRNRMWFFLFV--LSVAVNC 509
Fly 510 SFTIYFACYCVMIEG-----------------FTMLYVL-----GLIEAVV------FCGLGWIL 546
Fly 547 546 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Patsas | NP_001356957.1 | ANKYR | 113..306 | CDD:223738 | |
ANK repeat | 148..181 | CDD:293786 | |||
ANK repeat | 187..214 | CDD:293786 | |||
ANK repeat | 216..247 | CDD:293786 | |||
ANK repeat | 249..280 | CDD:293786 | |||
ANK repeat | 282..314 | CDD:293786 | |||
Ank_4 | 283..336 | CDD:316185 | 1/1 (100%) | ||
DHHC | 455..567 | CDD:334580 | 34/122 (28%) | ||
dhhc-12 | NP_492753.2 | zf-DHHC | 39..>172 | CDD:303066 | 40/156 (26%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C160165804 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.830 |