DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Patsas and dhhc-9

DIOPT Version :9

Sequence 1:	NP_001356957.1	Gene:	Patsas / 34634	FlyBaseID:	FBgn0029137	Length:	613	Species:	Drosophila melanogaster
Sequence 2:	NP_001362080.1	Gene:	dhhc-9 / 183426	WormBaseID:	WBGene00016620	Length:	313	Species:	Caenorhabditis elegans

Alignment Length:	208	Identity:	50/208 - (24%)
Similarity:	69/208 - (33%)	Gaps:	85/208 - (40%)

- Green bases have known domain annotations that are detailed below.

  Fly   357 LFGGAGDSKGPLFLFLFSVLLWGYPMYMIRAIPITWNILRRSHYCFIYWNAVMWISWAIANRRDP 421
            |.|..|      ..|||::   .|..|..|.||                        .:||..:.
Worm    76 LLGTCG------LYFLFNI---QYHYYKARTIP------------------------PVANPGEE 107

  Fly   422 GYIPLSSDAYYRAIKQIPYFDKLKKRNVMLTRLCHSCRCLRPLRAKHCRVCNRCVSYFDHHCPFI 486
            |      |::                       |..|...:...|.||.||.:||...||||.:|
Worm   108 G------DSF-----------------------CSKCNYWKSDNAHHCSVCEKCVLGMDHHCIWI 143

  Fly   487 YNCVGLRNRMWFFLFVLSVAVNCSFTIYFACY-----CVMIEGFTMLYVLGLIE----------- 535
            ..||||.|...||||:.::.: .:.||..|.|     .:.:|.....|...::|
Worm   144 NQCVGLHNHRHFFLFIANLTL-AAATIIIAGYQSFSDHLFLESSQTTYCTTILEHAPLQDIICDY 207

  Fly   536 ------AVVFCGL 542
                  :||||.|
Worm   208 DGFARTSVVFCYL 220

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Patsas	NP_001356957.1	ANKYR	113..306	CDD:223738
		ANK repeat	148..181	CDD:293786
		ANK repeat	187..214	CDD:293786
		ANK repeat	216..247	CDD:293786
		ANK repeat	249..280	CDD:293786
		ANK repeat	282..314	CDD:293786
		Ank_4	283..336	CDD:316185
		DHHC	455..567	CDD:334580	35/110 (32%)
dhhc-9	NP_001362080.1	DHHC	106..251	CDD:366691	37/145 (26%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C160165803
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5273
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	3	2.740