DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Patsas and unc-44

DIOPT Version :9

Sequence 1:NP_001356957.1 Gene:Patsas / 34634 FlyBaseID:FBgn0029137 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_001367345.1 Gene:unc-44 / 177366 WormBaseID:WBGene00006780 Length:6994 Species:Caenorhabditis elegans


Alignment Length:389 Identity:99/389 - (25%)
Similarity:147/389 - (37%) Gaps:123/389 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 VAEEDGHAHADDIHLDH--------RPHSPPLTGRGTDGGHGSS--GVEDHENVLLFEG--LDGA 110
            :|...||.:...:.|:.        |.:..||        |.::  |..:..|:||..|  :|..
 Worm   233 IAAHYGHENVGQLLLEKGANVNYQARHNISPL--------HVATKWGRTNMANLLLSRGAIIDSR 289

  Fly   111 TTVSLDDIFDIIKNGEVSEVENLVDKFGMECLSARDRHGYTPAHWIALNGNVQLMRYLIERTAPI 175
            |...|..:....::|....|:.||.:...  :||:.::|..|.|..|...:|...|.|:...||:
 Worm   290 TKDLLTPLHCAARSGHDQVVDLLVVQGAP--ISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPV 352

  Fly   176 D-------------LPC------------------LGTQGPRPIHWACRKGHASVVQVLLQAGVA 209
            |             ..|                  ....|..|:|.||:|....||::||:...|
 Worm   353 DDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAA 417

  Fly   210 VNAADFKGLTPLHLACMYGRTATAAYLLGMGALNNLTDINGDTALHWAAYKGHADLMRLLMYSGV 274
            :.|....||||||:|...|......|||..||..::..:.|:|.||.||.....|::|:|:.:|.
 Worm   418 IEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGA 482

  Fly   275 -------ELQ----------------------------KTDNF---------------------- 282
                   |||                            ..||:                      
 Worm   483 KVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHN 547

  Fly   283 ---------GSTPLHLACLSGNMTCVRLLCEK-SQLDLEPRDKNGKTPIMLAQAHQHQDVVRLL 336
                     |.||||||...||:..||||.|: :.:|:|  .||..||:.:| ||.:.|.|.:|
 Worm   548 ADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIE--GKNQVTPLHVA-AHYNNDKVAML 608

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PatsasNP_001356957.1 ANKYR 113..306 CDD:223738 72/290 (25%)
ANK repeat 148..181 CDD:293786 11/63 (17%)
ANK repeat 187..214 CDD:293786 11/26 (42%)
ANK repeat 216..247 CDD:293786 13/30 (43%)
ANK repeat 249..280 CDD:293786 13/65 (20%)
ANK repeat 282..314 CDD:293786 16/63 (25%)
Ank_4 283..336 CDD:316185 25/53 (47%)
DHHC 455..567 CDD:334580
unc-44NP_001367345.1 ANK repeat 32..63 CDD:293786
PHA03095 37..>387 CDD:222980 33/163 (20%)
ANK repeat 65..96 CDD:293786
ANK repeat 98..129 CDD:293786
ANK repeat 131..156 CDD:293786
ANK repeat 197..224 CDD:293786
ANK repeat 226..257 CDD:293786 4/23 (17%)
PHA02876 <242..>648 CDD:165207 96/380 (25%)
ANK repeat 259..290 CDD:293786 9/38 (24%)
ANK repeat 292..322 CDD:293786 6/31 (19%)
ANK repeat 325..356 CDD:293786 10/30 (33%)
ANK repeat 358..389 CDD:293786 1/30 (3%)
ANK repeat 391..422 CDD:293786 12/30 (40%)
ANK repeat 424..455 CDD:293786 13/30 (43%)
ANK repeat 457..488 CDD:293786 10/30 (33%)
ANK repeat 490..519 CDD:293786 3/28 (11%)
ANK repeat 523..552 CDD:293786 2/28 (7%)
Ank_2 555..>780 CDD:423045 26/57 (46%)
ANK repeat 556..586 CDD:293786 15/29 (52%)
ANK repeat 589..620 CDD:293786 9/21 (43%)
ANK repeat 622..652 CDD:293786
ANK repeat 655..685 CDD:293786
ANK repeat 688..719 CDD:293786
ANK repeat 721..752 CDD:293786
ANK repeat 754..784 CDD:293786
Ank_4 756..807 CDD:372654
ZU5 1008..1110 CDD:128514
UPA_2 1337..1472 CDD:375346
Death_ank 1503..1580 CDD:260029
PTZ00449 <1770..2112 CDD:185628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.