DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Patsas and ANKRD60

DIOPT Version :9

Sequence 1:	NP_001356957.1	Gene:	Patsas / 34634	FlyBaseID:	FBgn0029137	Length:	613	Species:	Drosophila melanogaster
Sequence 2:	NP_001291298.1	Gene:	ANKRD60 / 140731	HGNCID:	16217	Length:	345	Species:	Homo sapiens

Alignment Length:	116	Identity:	34/116 - (29%)
Similarity:	53/116 - (45%)	Gaps:	8/116 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly   220 PLHLACM------YGRTATAAYLLGMGALNNLTDINGDTALHWAAYKGHADLMRLLMYSGVELQK 278
            |..|:|:      :.|||.:.:..| ....:.|......||:.|:::||.|.::.|:..|.....
Human   185 PSKLSCLGLTEDSFYRTANSEHFEG-EKWKHWTSQRAFVALYVASHRGHFDAVQYLLEHGASCLS 248

  Fly   279 TDNFGSTPLHLACLSGNMTCVRLLCEKSQLDLEPRDKNGKTPIMLAQAHQH 329
            ....|.||||:|...|...|:.||.:.. ..:..||..|:|||.:|....|
Human   249 RSPLGRTPLHVAAAMGRSDCIILLLQHG-ASIHDRDAKGETPISIAHRLNH 298

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Patsas	NP_001356957.1	ANKYR	113..306	CDD:223738	26/91 (29%)
		ANK repeat	148..181	CDD:293786
		ANK repeat	187..214	CDD:293786
		ANK repeat	216..247	CDD:293786	7/32 (22%)
		ANK repeat	249..280	CDD:293786	8/30 (27%)
		ANK repeat	282..314	CDD:293786	10/31 (32%)
		Ank_4	283..336	CDD:316185	18/47 (38%)
		DHHC	455..567	CDD:334580
ANKRD60	NP_001291298.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..57
		UBL	103..163	CDD:176364
		ANK	171..298	CDD:238125	33/114 (29%)
		Ank_5	214..260	CDD:290568	14/45 (31%)
		ANK 1	219..249		8/29 (28%)
		ANK repeat	223..250	CDD:293786	8/26 (31%)
		Ank_5	239..293	CDD:290568	18/54 (33%)
		ANK repeat	252..283	CDD:293786	10/31 (32%)
		ANK 2	252..281		10/29 (34%)
		ANK repeat	285..318	CDD:293786	6/14 (43%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	0	0.000