DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Patsas and zdhhc14

DIOPT Version :9

Sequence 1:NP_001356957.1 Gene:Patsas / 34634 FlyBaseID:FBgn0029137 Length:613 Species:Drosophila melanogaster
Sequence 2:XP_004914695.1 Gene:zdhhc14 / 100489334 XenbaseID:XB-GENE-998053 Length:481 Species:Xenopus tropicalis


Alignment Length:310 Identity:85/310 - (27%)
Similarity:131/310 - (42%) Gaps:71/310 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 VKKKSRWIPSVSESWGWLFGGAG----DSK-------GPLFLFLFSVLL-------WGYPMYMIR 386
            :|||:    :|...|. :|.|..    |.:       |..:|.|..:|:       :..|...::
 Frog    22 IKKKA----TVRRKWE-VFPGRNKFYCDGRVMMARQTGVFYLTLILILVTSGLFFAFDCPYLAVK 81

  Fly   387 ---AIPITWNILRRSHYCFIYWNAVMWISWAIANRRDPGYIPLSS-DAYYRAIKQIP-------- 439
               |||:...||     .|.....::..|::     |||.:|.:: |......:||.        
 Frog    82 ITPAIPVIGGIL-----VFFVMGTLLRTSFS-----DPGVLPRATPDEAADLERQIDVANGSTSG 136

  Fly   440 -YFDKLKKRNVMLT------RLCHSCRCLRPLRAKHCRVCNRCVSYFDHHCPFIYNCVGLRNRMW 497
             |....:.:.|::.      :.|.:|:..||.||.||.:|:.||..||||||::.||||.||..:
 Frog   137 GYRPPPRTKEVVINGQTVKLKYCFTCKIFRPPRASHCSLCDNCVERFDHHCPWVGNCVGKRNYRF 201

  Fly   498 FFLFVLSVAVNCSFTIYFACYCVMI----EGFTMLYVL-----GLIEAVVFCGLGWILTCTSILH 553
            |::|:||::....|...|....|::    .||  |..|     .::||||.....|.:...|..|
 Frog   202 FYMFILSLSFLTVFIFAFVITHVILRSQQSGF--LNALKDSPASVLEAVVCFFSVWSIVGLSGFH 264

  Fly   554 ACM---NLTTNEMFNYKRYPYLRDKRGRYQ-NPFSRGPILNLLEFFVCLP 599
            ..:   |.||||.....    ...|||:.. ||:|.|.|.......:|.|
 Frog   265 TYLISSNQTTNEDIKGS----WSSKRGKENYNPYSYGNIFKNCCAALCGP 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PatsasNP_001356957.1 ANKYR 113..306 CDD:223738
ANK repeat 148..181 CDD:293786
ANK repeat 187..214 CDD:293786
ANK repeat 216..247 CDD:293786
ANK repeat 249..280 CDD:293786
ANK repeat 282..314 CDD:293786
Ank_4 283..336 CDD:316185
DHHC 455..567 CDD:334580 46/123 (37%)
zdhhc14XP_004914695.1 DHHC 156..279 CDD:366691 46/124 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.