DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Patsas and zdhhc4

DIOPT Version :9

Sequence 1:NP_001356957.1 Gene:Patsas / 34634 FlyBaseID:FBgn0029137 Length:613 Species:Drosophila melanogaster
Sequence 2:XP_002932482.2 Gene:zdhhc4 / 100488601 XenbaseID:XB-GENE-981756 Length:326 Species:Xenopus tropicalis


Alignment Length:308 Identity:74/308 - (24%)
Similarity:123/308 - (39%) Gaps:92/308 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   346 WIPSVSESWGWLFGGAGDSKGPLFLFLFSVL-LWGYPMYMIRAIPITWNILRRSHYC-------- 401
            |:|...:|......||       |:.|..:| :..:..|       :|.:|   .||        
 Frog    50 WLPRRYKSCFQTRNGA-------FVILHLILDILVFAEY-------SWEVL---GYCLELEISRP 97

  Fly   402 FIYW-------NAVMWISWAIANRRDPGYIPLSSDAYYRAIKQIPYFDKLKKRNVML---TRLCH 456
            ||:.       |...:.....|   |||.:...::|.|         .:|.:.:.:|   .:.|.
 Frog    98 FIFLPYICISVNLYFFYRCCAA---DPGIVNKKNEASY---------VQLYEYDCILFHPEQQCP 150

  Fly   457 SCRCLRPLRAKHCRVCNRCVSYFDHHCPFIYNCVGLRNRMWFFLFVLSV---AVNCSFTIY-FAC 517
            :|:..:|.|:||||||..|:..|||||.::.||:|..|..:|.::::|:   ||:.:..|. |..
 Frog   151 TCQITKPARSKHCRVCGCCIHRFDHHCVWVNNCIGGLNIRYFLIYLISLTLTAVSLAAVIMAFLL 215

  Fly   518 YCVMI-----------EGF------------------TMLYVLGLIEAVVFCGLGWILTCTSILH 553
            ..|::           ||.                  .:::.||.:..:|....|:   .:.:|:
 Frog   216 KVVLLSHMMSAAYIDPEGHEQMVNIAFIIQHLFLTFPRIVFTLGFLGILVLLLGGY---SSFLLY 277

  Fly   554 ACM-NLTTNEMFNYKRYPYLRDKRGRYQNPFSRGPILNLLEFF---VC 597
            .|: |.||||....|......|.|..|    |:|...|:.|.|   :|
 Frog   278 LCLSNQTTNEWHKQKGRSLALDSRKGY----SKGLWGNIQEIFQPPIC 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PatsasNP_001356957.1 ANKYR 113..306 CDD:223738
ANK repeat 148..181 CDD:293786
ANK repeat 187..214 CDD:293786
ANK repeat 216..247 CDD:293786
ANK repeat 249..280 CDD:293786
ANK repeat 282..314 CDD:293786
Ank_4 283..336 CDD:316185
DHHC 455..567 CDD:334580 40/145 (28%)
zdhhc4XP_002932482.2 DHHC 46..>210 CDD:418707 48/188 (26%)
DHHC 143..292 CDD:396215 40/151 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D445686at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.