| Sequence 1: | NP_001356957.1 | Gene: | Patsas / 34634 | FlyBaseID: | FBgn0029137 | Length: | 613 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_002663098.1 | Gene: | zdhhc12a / 100332332 | ZFINID: | ZDB-GENE-081104-40 | Length: | 270 | Species: | Danio rerio |
| Alignment Length: | 202 | Identity: | 63/202 - (31%) |
|---|---|---|---|
| Similarity: | 88/202 - (43%) | Gaps: | 39/202 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 420 DPGYI-------PLSSDAYYRAIKQIPYFDKLKKRNVMLTRLCHSCRCLRPLRAKHCRVCNRCVS 477
Fly 478 YFDHHCPFIYNCVGLRNRMWFFLFVLSVAVNCSFTIYFACYCVMIE----GF------------T 526
Fly 527 MLYVLGLIEAVVFCGLGWILTCTSILHACMNLTTNEMFNYKRYPYLRDKRGRYQNPFSRGPILNL 591
Fly 592 LEF-FVC 597 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Patsas | NP_001356957.1 | ANKYR | 113..306 | CDD:223738 | |
| ANK repeat | 148..181 | CDD:293786 | |||
| ANK repeat | 187..214 | CDD:293786 | |||
| ANK repeat | 216..247 | CDD:293786 | |||
| ANK repeat | 249..280 | CDD:293786 | |||
| ANK repeat | 282..314 | CDD:293786 | |||
| Ank_4 | 283..336 | CDD:316185 | |||
| DHHC | 455..567 | CDD:334580 | 41/127 (32%) | ||
| zdhhc12a | XP_002663098.1 | DHHC | 104..221 | CDD:396215 | 41/125 (33%) |
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||