DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Patsas and zdhhc16

DIOPT Version :9

Sequence 1:NP_001356957.1 Gene:Patsas / 34634 FlyBaseID:FBgn0029137 Length:613 Species:Drosophila melanogaster
Sequence 2:XP_031760679.1 Gene:zdhhc16 / 100145301 XenbaseID:XB-GENE-957764 Length:371 Species:Xenopus tropicalis


Alignment Length:320 Identity:76/320 - (23%)
Similarity:116/320 - (36%) Gaps:87/320 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   332 VVRLLYGEVKKKSRWIPSVSESWGWLFGGAGDSKGPLFLFLFSVLLWGYPMYM-IRAIP------ 389
            :|.|.|.........|.|:.|...||........|.:|:.|..||.....:.: |..:|      
 Frog    40 IVSLAYNSFTNSDVVIESLFEPVYWLVDHVTRWFGIVFVALVIVLTSSIVLIVYICVLPLIIQTY 104

  Fly   390 ----ITWNILRRSHYCFIYWNAVMWISWAIANRRDPGYIPLSSDAYYRAIKQIPYFDKLKKRNVM 450
                |.|      |..:.:||.:|.:.                 .||:||...|.:....:.::.
 Frog   105 STPWIYW------HVIYGHWNLIMIVF-----------------HYYKAITTPPGYPSQMETDIP 146

  Fly   451 LTRLCHSCRCLRPLRAKHCRVCNRCVSYFDHHCPFIYNCVGLRNRMWFFLFVLSVAVNCSFTIY- 514
            ...:|..|...:|.|..||.:|:|||...|||||::.||||..|..:||.|.|.:.:.|   || 
 Frog   147 SVSICRKCIAHKPARTHHCSICSRCVLKMDHHCPWLNNCVGHYNHRYFFSFCLFMTMGC---IYC 208

  Fly   515 -FACYCVMIEGFTMLYVLGLIE-----------------------------AVVFCGLGWILTCT 549
             |:...:..|.::.:..:.|.|                             .:::.   |:| |:
 Frog   209 SFSSRVMFREAYSAIEKMKLQEKERLQFAANETYNDTPPPTFTFRERMFHKCIIYL---WVL-CS 269

  Fly   550 SIL---------HACMNLTTNEM-----FNYKRYPYLRDKRGRYQNPFSRGPILNLLEFF 595
            |:.         || |.:|..|.     .|.|....|......:.||:|.|...|...||
 Frog   270 SVALALGALTLWHA-MLITRGETSIERHINKKERKRLESIGKVFYNPYSYGRSGNWKVFF 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PatsasNP_001356957.1 ANKYR 113..306 CDD:223738
ANK repeat 148..181 CDD:293786
ANK repeat 187..214 CDD:293786
ANK repeat 216..247 CDD:293786
ANK repeat 249..280 CDD:293786
ANK repeat 282..314 CDD:293786
Ank_4 283..336 CDD:316185 1/3 (33%)
DHHC 455..567 CDD:334580 41/156 (26%)
zdhhc16XP_031760679.1 DHHC 150..299 CDD:396215 40/156 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.