DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Patsas and zdhhc20b

DIOPT Version :9

Sequence 1:NP_001356957.1 Gene:Patsas / 34634 FlyBaseID:FBgn0029137 Length:613 Species:Drosophila melanogaster
Sequence 2:XP_005162815.2 Gene:zdhhc20b / 100001188 ZFINID:ZDB-GENE-091117-30 Length:409 Species:Danio rerio


Alignment Length:313 Identity:78/313 - (24%)
Similarity:112/313 - (35%) Gaps:99/313 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   346 WIPSVSESWGWLFGGAGDSKGPLFLFLFSVLLWGYPMYMIRAIPITWN-------ILRRSHYCFI 403
            |||                    .:|:..|:.|.|..|::....:|.:       .|...|..|:
Zfish    48 WIP--------------------VIFIALVVCWSYYAYVVELCLLTISSTGEKIVYLVVFHLSFV 92

  Fly   404 YWNAVMWISWAI-----ANRRDPGYIPLSSDAYYRAIKQIPYFDK--LKKRNVML---------- 451
            .:   :|..|..     ||......:|.|....|.. :|.|...:  |||....|          
Zfish    93 MF---VWSYWKTIFTKPANPSKEFCLPKSEKEQYEK-EQRPETQQEILKKVATSLPLYTRTGAGA 153

  Fly   452 TRLCHSCRCLRPLRAKHCRVCNRCVSYFDHHCPFIYNCVGLRNRMWFFLFVLSVAVNCSFTIYFA 516
            .|.|..|:.::|.|..||..|:.||...|||||::.||||..|..:|.||:          .|..
Zfish   154 IRYCDRCQVIKPDRCHHCSACDMCVLKMDHHCPWVNNCVGFSNYKFFILFL----------TYSL 208

  Fly   517 CYCVMIEGFTMLYVL-----------------GLIEA-----VVFCGLGWILTCTSIL-----HA 554
            .||:.|....:.|.:                 .|.|:     |:|......:.|.|||     |.
Zfish   209 VYCLFIAASVLQYFIKFWTLCRRKSAENCPKSDLPESHAKFHVLFLFFVAAMFCISILSLFTYHL 273

  Fly   555 CM---NLTTNEMFNYKRYPYLRDKRGRYQNPFSRGPILNLLEFFVCLPDRGDD 604
            .:   |.:|.|.|   |.|..|:  |..:|.||.|...|:.:.|      ||:
Zfish   274 WLVGKNRSTIEAF---RAPVFRN--GPDKNGFSLGFSKNIAQVF------GDE 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PatsasNP_001356957.1 ANKYR 113..306 CDD:223738
ANK repeat 148..181 CDD:293786
ANK repeat 187..214 CDD:293786
ANK repeat 216..247 CDD:293786
ANK repeat 249..280 CDD:293786
ANK repeat 282..314 CDD:293786
Ank_4 283..336 CDD:316185
DHHC 455..567 CDD:334580 40/141 (28%)
zdhhc20bXP_005162815.2 zf-DHHC 44..342 CDD:327686 78/313 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.